BLASTX nr result
ID: Mentha27_contig00046370
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00046370 (415 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_054499.1| hypothetical protein NitaCp023 [Nicotiana tabac... 68 1e-09 >ref|NP_054499.1| hypothetical protein NitaCp023 [Nicotiana tabacum] gi|78102535|ref|YP_358676.1| hypothetical protein NisyCp029 [Nicotiana sylvestris] gi|11833|emb|CAA77353.1| hypothetical protein [Nicotiana tabacum] gi|77799562|dbj|BAE46651.1| hypothetical protein [Nicotiana sylvestris] gi|225201|prf||1211235AF ORF 74A Length = 74 Score = 68.2 bits (165), Expect = 1e-09 Identities = 37/64 (57%), Positives = 43/64 (67%), Gaps = 3/64 (4%) Frame = +3 Query: 210 ISC*FL*KRNNWNRKPI--IFFCKSIYFYVISYCI-IFSLWDHFPTRGNEKN*KMDCWLC 380 IS FL KRNNWNR I +FF K +++ I FSLWD FP RGNEKN +MDC+LC Sbjct: 11 ISYRFLSKRNNWNRGFISFVFFLKKKEVFMLFRTIQFFSLWDLFPMRGNEKNSRMDCYLC 70 Query: 381 LDRG 392 LD G Sbjct: 71 LDHG 74