BLASTX nr result
ID: Mentha27_contig00046347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00046347 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517227.1| WD-repeat protein, putative [Ricinus communi... 58 1e-06 >ref|XP_002517227.1| WD-repeat protein, putative [Ricinus communis] gi|223543598|gb|EEF45127.1| WD-repeat protein, putative [Ricinus communis] Length = 654 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/61 (44%), Positives = 41/61 (67%), Gaps = 2/61 (3%) Frame = +2 Query: 125 YFDTTDYLMFEEE--SSDYDIWLREPLSVEERRKSFLVEMGFSERSISGETEAVEMERVD 298 +FD+ D L EE + +Y+IWL EP SV+ERR+SFL EMG +E + + E + ++R+ Sbjct: 12 FFDSVDCLSPEESIVNKEYEIWLNEPQSVKERRQSFLCEMGLTELACKSDNEIIGLQRIS 71 Query: 299 E 301 E Sbjct: 72 E 72