BLASTX nr result
ID: Mentha27_contig00046220
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00046220 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27934.1| hypothetical protein MIMGU_mgv1a021148mg [Mimulus... 56 6e-06 >gb|EYU27934.1| hypothetical protein MIMGU_mgv1a021148mg [Mimulus guttatus] Length = 422 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/42 (69%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = +2 Query: 218 TSFLSELLSRLQRSKKA-FYALISLLTLCLLPYNSASIFCTH 340 T FLS+LL +RSK++ FYA ISLL LCLL YNSASIFC H Sbjct: 5 TCFLSQLLLHWRRSKRSSFYAFISLLLLCLLAYNSASIFCIH 46