BLASTX nr result
ID: Mentha27_contig00046207
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00046207 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45367.1| hypothetical protein MIMGU_mgv1a020188mg [Mimulus... 68 1e-09 ref|XP_002519960.1| protein with unknown function [Ricinus commu... 63 4e-08 gb|AHB20162.1| DNA methyltransferase, partial [Populus x canaden... 60 3e-07 ref|XP_006385691.1| hypothetical protein POPTR_0003s09930g [Popu... 60 3e-07 >gb|EYU45367.1| hypothetical protein MIMGU_mgv1a020188mg [Mimulus guttatus] Length = 885 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/41 (85%), Positives = 38/41 (92%), Gaps = 1/41 (2%) Frame = +3 Query: 3 VAVSVGRALGYSLGMAVKRLSGDG-HLFTLPPKFSHSTTVE 122 VAVSVGRALGYSLGMAV++LSG+ HL TLPPKFSHSTTVE Sbjct: 835 VAVSVGRALGYSLGMAVQKLSGENEHLTTLPPKFSHSTTVE 875 >ref|XP_002519960.1| protein with unknown function [Ricinus communis] gi|223541006|gb|EEF42564.1| protein with unknown function [Ricinus communis] Length = 734 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +3 Query: 3 VAVSVGRALGYSLGMAVKRLSGDGHLFTLPPKFSHSTTVE 122 VAV VGRALGY+LGMA +LSGDG L TLPPKFSHST ++ Sbjct: 685 VAVPVGRALGYALGMAFLKLSGDGPLMTLPPKFSHSTNLQ 724 >gb|AHB20162.1| DNA methyltransferase, partial [Populus x canadensis] Length = 755 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +3 Query: 3 VAVSVGRALGYSLGMAVKRLSGDGHLFTLPPKFSHSTTVE 122 VAV VGRALG++LGMA ++LSGD L TLPPKFSHST ++ Sbjct: 706 VAVPVGRALGFTLGMAFQKLSGDDPLMTLPPKFSHSTNLQ 745 >ref|XP_006385691.1| hypothetical protein POPTR_0003s09930g [Populus trichocarpa] gi|550342853|gb|ERP63488.1| hypothetical protein POPTR_0003s09930g [Populus trichocarpa] Length = 130 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +3 Query: 3 VAVSVGRALGYSLGMAVKRLSGDGHLFTLPPKFSHSTTVE 122 VAV VGRALG++LGMA ++LSGD L TLPPKFSHST ++ Sbjct: 81 VAVPVGRALGFTLGMAFQKLSGDDPLMTLPPKFSHSTNLQ 120