BLASTX nr result
ID: Mentha27_contig00046153
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00046153 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30866.1| hypothetical protein MIMGU_mgv1a026315mg [Mimulus... 62 1e-07 ref|XP_006469284.1| PREDICTED: U-box domain-containing protein 2... 60 2e-07 ref|XP_006448117.1| hypothetical protein CICLE_v10015253mg [Citr... 60 2e-07 ref|XP_004142305.1| PREDICTED: U-box domain-containing protein 2... 60 2e-07 ref|XP_003530079.1| PREDICTED: U-box domain-containing protein 2... 60 2e-07 ref|XP_003600684.1| U-box domain-containing protein [Medicago tr... 60 3e-07 ref|XP_004503116.1| PREDICTED: U-box domain-containing protein 2... 60 4e-07 ref|XP_007215376.1| hypothetical protein PRUPE_ppa005711mg [Prun... 59 5e-07 gb|EXC05057.1| U-box domain-containing protein 20 [Morus notabilis] 59 9e-07 ref|XP_007224745.1| hypothetical protein PRUPE_ppa024359mg [Prun... 59 9e-07 ref|XP_002527537.1| Spotted leaf protein, putative [Ricinus comm... 59 9e-07 ref|XP_007045491.1| ARM repeat superfamily protein, putative [Th... 58 1e-06 gb|AAK69400.1|AF274563_1 immediate-early fungal elicitor protein... 58 1e-06 gb|AAK69401.1|AF274564_1 immediate-early fungal elicitor protein... 58 1e-06 ref|XP_003631249.1| PREDICTED: U-box domain-containing protein 2... 57 2e-06 ref|XP_003533316.1| PREDICTED: U-box domain-containing protein 2... 57 2e-06 emb|CBI26797.3| unnamed protein product [Vitis vinifera] 57 2e-06 gb|EXB94294.1| U-box domain-containing protein 20 [Morus notabilis] 57 3e-06 ref|XP_007152651.1| hypothetical protein PHAVU_004G147500g [Phas... 57 3e-06 ref|XP_004490855.1| PREDICTED: U-box domain-containing protein 2... 57 3e-06 >gb|EYU30866.1| hypothetical protein MIMGU_mgv1a026315mg [Mimulus guttatus] Length = 452 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/47 (63%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 128 GAGKRDGQK--ITNTVTELTVPTHFRCPISLHLMKDPVSLATGITYD 262 GAGK + K I ELT+P HF+CPISL LMKDPV+L+TGITYD Sbjct: 14 GAGKDETSKGIINQDSMELTIPVHFKCPISLDLMKDPVTLSTGITYD 60 >ref|XP_006469284.1| PREDICTED: U-box domain-containing protein 21-like [Citrus sinensis] Length = 444 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 4/49 (8%) Frame = +2 Query: 128 GAGKRDGQKITNTVT----ELTVPTHFRCPISLHLMKDPVSLATGITYD 262 G G+R G+K + ELT P HFRCPISL LMKDPV+L+TGITYD Sbjct: 11 GRGRRAGKKQPGVESGGEMELTTPNHFRCPISLDLMKDPVTLSTGITYD 59 >ref|XP_006448117.1| hypothetical protein CICLE_v10015253mg [Citrus clementina] gi|557550728|gb|ESR61357.1| hypothetical protein CICLE_v10015253mg [Citrus clementina] Length = 444 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 4/49 (8%) Frame = +2 Query: 128 GAGKRDGQKITNTVT----ELTVPTHFRCPISLHLMKDPVSLATGITYD 262 G G+R G+K + ELT P HFRCPISL LMKDPV+L+TGITYD Sbjct: 11 GRGRRAGKKQPGVESGGEMELTTPNHFRCPISLDLMKDPVTLSTGITYD 59 >ref|XP_004142305.1| PREDICTED: U-box domain-containing protein 21-like [Cucumis sativus] gi|449523075|ref|XP_004168550.1| PREDICTED: U-box domain-containing protein 21-like [Cucumis sativus] Length = 444 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 173 ELTVPTHFRCPISLHLMKDPVSLATGITYD 262 ELT+PTHFRCPISL LMKDPV+L+TGITYD Sbjct: 24 ELTIPTHFRCPISLDLMKDPVTLSTGITYD 53 >ref|XP_003530079.1| PREDICTED: U-box domain-containing protein 21-like [Glycine max] Length = 437 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +2 Query: 137 KRDGQKITNTVTELTVPTHFRCPISLHLMKDPVSLATGITYD 262 +R G K ++TEL +P HFRCPISL LMKDPV+L+TGITYD Sbjct: 15 RRKGGK---SITELVIPNHFRCPISLDLMKDPVTLSTGITYD 53 >ref|XP_003600684.1| U-box domain-containing protein [Medicago truncatula] gi|355489732|gb|AES70935.1| U-box domain-containing protein [Medicago truncatula] Length = 439 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = +2 Query: 134 GKRDGQKITNTVTELTVPTHFRCPISLHLMKDPVSLATGITYD 262 G DG+ TV E+T+PT+FRCP+SL LMKDPV+L+TGITYD Sbjct: 23 GAGDGEL---TVEEITIPTNFRCPVSLDLMKDPVTLSTGITYD 62 >ref|XP_004503116.1| PREDICTED: U-box domain-containing protein 21-like [Cicer arietinum] Length = 435 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 167 VTELTVPTHFRCPISLHLMKDPVSLATGITYD 262 V E+T+PTHFRCP+SL LMKDPV+L TGITYD Sbjct: 28 VEEITIPTHFRCPVSLDLMKDPVTLPTGITYD 59 >ref|XP_007215376.1| hypothetical protein PRUPE_ppa005711mg [Prunus persica] gi|462411526|gb|EMJ16575.1| hypothetical protein PRUPE_ppa005711mg [Prunus persica] Length = 447 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +2 Query: 146 GQKITNTVTELTVPTHFRCPISLHLMKDPVSLATGITYD 262 G+ + + E+ VPTHFRCPISL LMKDPV+L+TG+TYD Sbjct: 23 GENLDMEMEEIAVPTHFRCPISLDLMKDPVTLSTGMTYD 61 >gb|EXC05057.1| U-box domain-containing protein 20 [Morus notabilis] Length = 454 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 173 ELTVPTHFRCPISLHLMKDPVSLATGITYD 262 ELT+P+HFRCPISL LMKDPV+L TGITYD Sbjct: 30 ELTIPSHFRCPISLDLMKDPVTLTTGITYD 59 >ref|XP_007224745.1| hypothetical protein PRUPE_ppa024359mg [Prunus persica] gi|462421681|gb|EMJ25944.1| hypothetical protein PRUPE_ppa024359mg [Prunus persica] Length = 447 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 173 ELTVPTHFRCPISLHLMKDPVSLATGITYD 262 ELT+P HFRCPISL LMKDPV+L+TGITYD Sbjct: 29 ELTIPNHFRCPISLDLMKDPVTLSTGITYD 58 >ref|XP_002527537.1| Spotted leaf protein, putative [Ricinus communis] gi|223533087|gb|EEF34846.1| Spotted leaf protein, putative [Ricinus communis] Length = 426 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +2 Query: 137 KRDGQKITNTVTELTVPTHFRCPISLHLMKDPVSLATGITYD 262 +++ ++ N EL +P HFRCPISL LMKDPV+L+TGITYD Sbjct: 15 RKERLEVENGDMELAIPNHFRCPISLDLMKDPVTLSTGITYD 56 >ref|XP_007045491.1| ARM repeat superfamily protein, putative [Theobroma cacao] gi|508709426|gb|EOY01323.1| ARM repeat superfamily protein, putative [Theobroma cacao] Length = 438 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +2 Query: 131 AGKRDGQKITNTVTELTVPTHFRCPISLHLMKDPVSLATGITYD 262 AGK G+ N ELT+P FRCPISL LMKDPV+L+TGITYD Sbjct: 15 AGKEPGRN-ENGEMELTIPRDFRCPISLDLMKDPVTLSTGITYD 57 >gb|AAK69400.1|AF274563_1 immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] Length = 230 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = +2 Query: 122 SHGAGKRDGQKITNTVTELTVPTHFRCPISLHLMKDPVSLATGITYD 262 S A KR+G + + E+++P HFRCPISL LMKDPV+L+TGITYD Sbjct: 11 SRHANKRNGLDDLSNM-EVSIPNHFRCPISLDLMKDPVTLSTGITYD 56 >gb|AAK69401.1|AF274564_1 immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] gi|14582202|gb|AAK69402.1|AF274565_1 immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] Length = 442 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = +2 Query: 122 SHGAGKRDGQKITNTVTELTVPTHFRCPISLHLMKDPVSLATGITYD 262 S A KR+G + + E+++P HFRCPISL LMKDPV+L+TGITYD Sbjct: 11 SRHANKRNGLDDLSNM-EVSIPNHFRCPISLDLMKDPVTLSTGITYD 56 >ref|XP_003631249.1| PREDICTED: U-box domain-containing protein 21-like [Vitis vinifera] Length = 442 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 173 ELTVPTHFRCPISLHLMKDPVSLATGITYD 262 ELT P HFRCPISL LMKDPV+L+TGITYD Sbjct: 29 ELTTPNHFRCPISLDLMKDPVTLSTGITYD 58 >ref|XP_003533316.1| PREDICTED: U-box domain-containing protein 21-like [Glycine max] Length = 438 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +2 Query: 140 RDGQKITNTVTELTVPTHFRCPISLHLMKDPVSLATGITYD 262 ++ +K ++ EL P HFRCPISL LMKDPV+L+TGITYD Sbjct: 13 KNRRKGGKSIAELVTPNHFRCPISLDLMKDPVTLSTGITYD 53 >emb|CBI26797.3| unnamed protein product [Vitis vinifera] Length = 355 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 173 ELTVPTHFRCPISLHLMKDPVSLATGITYD 262 ELT P HFRCPISL LMKDPV+L+TGITYD Sbjct: 29 ELTTPNHFRCPISLDLMKDPVTLSTGITYD 58 >gb|EXB94294.1| U-box domain-containing protein 20 [Morus notabilis] Length = 455 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +2 Query: 167 VTELTVPTHFRCPISLHLMKDPVSLATGITYD 262 +TE+ +P HFRCPI+L LMKDPV+L+TGITYD Sbjct: 24 MTEIVIPAHFRCPITLDLMKDPVTLSTGITYD 55 >ref|XP_007152651.1| hypothetical protein PHAVU_004G147500g [Phaseolus vulgaris] gi|561025960|gb|ESW24645.1| hypothetical protein PHAVU_004G147500g [Phaseolus vulgaris] Length = 437 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 167 VTELTVPTHFRCPISLHLMKDPVSLATGITYD 262 V E+ VP HFRCPISL LMKDPV+L+TGITYD Sbjct: 21 VMEVVVPNHFRCPISLDLMKDPVTLSTGITYD 52 >ref|XP_004490855.1| PREDICTED: U-box domain-containing protein 21-like [Cicer arietinum] Length = 446 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/45 (57%), Positives = 34/45 (75%), Gaps = 4/45 (8%) Frame = +2 Query: 140 RDGQKITNTVT----ELTVPTHFRCPISLHLMKDPVSLATGITYD 262 R G+ I N+ E+ +PTHFRCPI+L +MKDPV+L+TGITYD Sbjct: 16 RKGKDILNSSNDLQVEIAIPTHFRCPITLDIMKDPVTLSTGITYD 60