BLASTX nr result
ID: Mentha27_contig00046075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00046075 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36123.1| hypothetical protein MIMGU_mgv1a0009921mg, partia... 60 4e-07 >gb|EYU36123.1| hypothetical protein MIMGU_mgv1a0009921mg, partial [Mimulus guttatus] Length = 905 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 169 DMDTSEIVVSSIRAGMKREFAFMMKAQSEMGGLPA 273 DMD+ EIVVSSIRAGMKREFA MMKAQS++GGL A Sbjct: 1 DMDSGEIVVSSIRAGMKREFALMMKAQSQLGGLSA 35