BLASTX nr result
ID: Mentha27_contig00045790
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00045790 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588297.1| Cytochrome c biogenesis FN [Medicago truncat... 46 7e-10 ref|XP_006842416.1| hypothetical protein AMTR_s04495p00001190, p... 61 1e-07 ref|XP_003596847.1| hypothetical protein MTR_2g086750 [Medicago ... 60 3e-07 ref|YP_006666116.1| CcmFN (mitochondrion) [Malus domestica] gi|4... 58 1e-06 >ref|XP_003588297.1| Cytochrome c biogenesis FN [Medicago truncatula] gi|355477345|gb|AES58548.1| Cytochrome c biogenesis FN [Medicago truncatula] Length = 856 Score = 46.2 bits (108), Expect(2) = 7e-10 Identities = 26/45 (57%), Positives = 28/45 (62%) Frame = -3 Query: 276 WASFDASTPNKLRVEIVELSLEK*VSWSLFGHKDNRSS*VRGGPA 142 WAS DA TPNKL V IV+L SLFGHKDN S +R G A Sbjct: 259 WASLDAPTPNKLLVGIVKL--------SLFGHKDNSSYLIRSGAA 295 Score = 42.7 bits (99), Expect(2) = 7e-10 Identities = 27/54 (50%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -2 Query: 160 GQGRAGHRFESCHLSCGSSCGYRMMGITKQKF*NEHEMSI-YEFFHYSLFLGLF 2 GQGRAGHRFES +EHEM I YEFFH SLF GLF Sbjct: 328 GQGRAGHRFES----------------------SEHEMYIIYEFFHLSLFPGLF 359 >ref|XP_006842416.1| hypothetical protein AMTR_s04495p00001190, partial [Amborella trichopoda] gi|548844500|gb|ERN04091.1| hypothetical protein AMTR_s04495p00001190, partial [Amborella trichopoda] Length = 204 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/53 (60%), Positives = 38/53 (71%) Frame = -2 Query: 160 GQGRAGHRFESCHLSCGSSCGYRMMGITKQKF*NEHEMSIYEFFHYSLFLGLF 2 GQG AGHRF+S HL CGSSCGY+MM +++ EHEMSI E + LF GLF Sbjct: 110 GQGWAGHRFKSYHLYCGSSCGYQMM-LSQLILKYEHEMSINELSYSLLFSGLF 161 >ref|XP_003596847.1| hypothetical protein MTR_2g086750 [Medicago truncatula] gi|355485895|gb|AES67098.1| hypothetical protein MTR_2g086750 [Medicago truncatula] Length = 202 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 85 PSSGNHRMIHKKGGRIRTYGRPAPDL 162 PSSGNHRMIHKKGGRIRTYGRPAPDL Sbjct: 25 PSSGNHRMIHKKGGRIRTYGRPAPDL 50 >ref|YP_006666116.1| CcmFN (mitochondrion) [Malus domestica] gi|401661921|emb|CBX33376.1| ccmFN (mitochondrion) [Malus domestica] Length = 587 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -2 Query: 91 MMGITKQKF*NEHEMSIYEFFHYSLFLGLF 2 MMGITKQKF NEHEMSIYE FHYSLF GLF Sbjct: 1 MMGITKQKFLNEHEMSIYELFHYSLFPGLF 30