BLASTX nr result
ID: Mentha27_contig00045778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00045778 (414 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006384977.1| hypothetical protein POPTR_0004s22750g, part... 97 2e-18 ref|XP_006361254.1| PREDICTED: pentatricopeptide repeat-containi... 97 3e-18 ref|XP_004493626.1| PREDICTED: pentatricopeptide repeat-containi... 94 2e-17 ref|XP_004244671.1| PREDICTED: pentatricopeptide repeat-containi... 94 2e-17 ref|XP_007224413.1| hypothetical protein PRUPE_ppa021206mg [Prun... 86 7e-15 ref|XP_004148898.1| PREDICTED: pentatricopeptide repeat-containi... 85 9e-15 ref|XP_002443092.1| hypothetical protein SORBIDRAFT_08g008260 [S... 80 2e-13 ref|XP_003625322.1| Pentatricopeptide repeat protein [Medicago t... 80 3e-13 ref|XP_007162366.1| hypothetical protein PHAVU_001G146000g [Phas... 80 4e-13 gb|AFW76727.1| hypothetical protein ZEAMMB73_427029 [Zea mays] 75 1e-11 gb|AFW76726.1| hypothetical protein ZEAMMB73_427029 [Zea mays] 74 2e-11 gb|EMT07478.1| hypothetical protein F775_00276 [Aegilops tauschii] 74 3e-11 gb|EMT07476.1| hypothetical protein F775_15307 [Aegilops tauschii] 74 3e-11 ref|XP_004963495.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_003604256.1| Pentatricopeptide repeat-containing protein ... 72 8e-11 gb|EXC31089.1| hypothetical protein L484_001076 [Morus notabilis] 71 2e-10 ref|XP_006657524.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-10 ref|XP_007143361.1| hypothetical protein PHAVU_007G066000g [Phas... 70 2e-10 ref|XP_004510744.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 ref|NP_001066448.1| Os12g0233200 [Oryza sativa Japonica Group] g... 70 3e-10 >ref|XP_006384977.1| hypothetical protein POPTR_0004s22750g, partial [Populus trichocarpa] gi|550341745|gb|ERP62774.1| hypothetical protein POPTR_0004s22750g, partial [Populus trichocarpa] Length = 292 Score = 97.1 bits (240), Expect = 2e-18 Identities = 43/69 (62%), Positives = 54/69 (78%) Frame = -2 Query: 413 CANKKKWGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYKVLAEI 234 CA+ ++WGDV+MAR MMRE+ +KK PG S+VEVEG+FHEFLAGDE HPQSE IY L ++ Sbjct: 221 CASGRRWGDVKMARRMMRERRVKKIPGRSIVEVEGQFHEFLAGDESHPQSEGIYNALDQL 280 Query: 233 LLFPKLDYC 207 KL+ C Sbjct: 281 FAMSKLEDC 289 >ref|XP_006361254.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Solanum tuberosum] Length = 597 Score = 96.7 bits (239), Expect = 3e-18 Identities = 43/77 (55%), Positives = 58/77 (75%) Frame = -2 Query: 413 CANKKKWGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYKVLAEI 234 CAN++KW DVRM RS+MR K +KKNPG SL+EV+G F+EF+A D+ HP+S+AI+K+L EI Sbjct: 520 CANERKWADVRMVRSLMRAKGVKKNPGHSLIEVDGNFYEFVAADDSHPESQAIHKMLDEI 579 Query: 233 LLFPKLDYCTLDGYQNQ 183 +L KL+ D Q Sbjct: 580 ILLSKLEEYVSDAQPEQ 596 >ref|XP_004493626.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Cicer arietinum] Length = 666 Score = 94.0 bits (232), Expect = 2e-17 Identities = 43/72 (59%), Positives = 53/72 (73%) Frame = -2 Query: 413 CANKKKWGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYKVLAEI 234 CAN +KW DVR RS+MR+K +KK PG SL+E++G F EFL DE HPQSE IYKVL EI Sbjct: 594 CANDRKWSDVRRVRSLMRDKGVKKIPGHSLIEIDGDFIEFLVADESHPQSEEIYKVLDEI 653 Query: 233 LLFPKLDYCTLD 198 L KL+ C+ + Sbjct: 654 FLLSKLEDCSCE 665 >ref|XP_004244671.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Solanum lycopersicum] Length = 529 Score = 94.0 bits (232), Expect = 2e-17 Identities = 42/77 (54%), Positives = 57/77 (74%) Frame = -2 Query: 413 CANKKKWGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYKVLAEI 234 CAN++KW DVRM RS+MR K +KKNPG SL+EV+G F+EF+A D+ H +S+AI+K+L EI Sbjct: 452 CANERKWADVRMVRSLMRAKGVKKNPGHSLIEVDGNFYEFVAADDSHHESQAIHKILDEI 511 Query: 233 LLFPKLDYCTLDGYQNQ 183 +L KL+ D Q Sbjct: 512 ILLSKLEEYVSDAQPEQ 528 >ref|XP_007224413.1| hypothetical protein PRUPE_ppa021206mg [Prunus persica] gi|462421349|gb|EMJ25612.1| hypothetical protein PRUPE_ppa021206mg [Prunus persica] Length = 597 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/55 (65%), Positives = 47/55 (85%) Frame = -2 Query: 410 ANKKKWGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYKV 246 ANKK+W DVR+ RS+M+E+ ++KNPG SL+EVEG+FHEFLA D+ HPQ E IYK+ Sbjct: 527 ANKKRWDDVRIVRSLMKERGVRKNPGHSLIEVEGEFHEFLAADKSHPQLEEIYKI 581 >ref|XP_004148898.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Cucumis sativus] Length = 675 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/66 (59%), Positives = 48/66 (72%) Frame = -2 Query: 413 CANKKKWGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYKVLAEI 234 CA+ KKW DVRM R MMRE+ +KK PG SL+E+EGKFHEFL D H +S IY+V+ E+ Sbjct: 600 CADGKKWKDVRMVRRMMRERGVKKVPGHSLIEIEGKFHEFLVADTSHTRSSEIYRVVNEL 659 Query: 233 LLFPKL 216 LL L Sbjct: 660 LLLSSL 665 >ref|XP_002443092.1| hypothetical protein SORBIDRAFT_08g008260 [Sorghum bicolor] gi|241943785|gb|EES16930.1| hypothetical protein SORBIDRAFT_08g008260 [Sorghum bicolor] Length = 655 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/66 (56%), Positives = 47/66 (71%) Frame = -2 Query: 410 ANKKKWGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYKVLAEIL 231 A+K KWG V+M R++MR++ +KKNPG S +EV+GKFHEFLA D H SE IY L I Sbjct: 580 ASKSKWGQVKMIRTVMRDRGVKKNPGCSSIEVDGKFHEFLAADVSHAHSEDIYAALENIY 639 Query: 230 LFPKLD 213 L KL+ Sbjct: 640 LHSKLE 645 >ref|XP_003625322.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355500337|gb|AES81540.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 1024 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/68 (54%), Positives = 48/68 (70%) Frame = -2 Query: 413 CANKKKWGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYKVLAEI 234 CAN +KW DVR RS+M++K +KK PG SL+E++G F EFL DE HPQSE IYK+ + Sbjct: 704 CANDRKWSDVRRVRSLMKDKGVKKIPGYSLIEIDGGFVEFLVADESHPQSEEIYKLECDN 763 Query: 233 LLFPKLDY 210 L KL + Sbjct: 764 LSSKKLTW 771 >ref|XP_007162366.1| hypothetical protein PHAVU_001G146000g [Phaseolus vulgaris] gi|561035830|gb|ESW34360.1| hypothetical protein PHAVU_001G146000g [Phaseolus vulgaris] Length = 670 Score = 79.7 bits (195), Expect = 4e-13 Identities = 34/54 (62%), Positives = 44/54 (81%) Frame = -2 Query: 410 ANKKKWGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYK 249 AN++KWGDVR RS+MR+K +KK PG SL+E++G+F EFL DE HPQSE IY+ Sbjct: 595 ANERKWGDVRRVRSLMRDKGVKKIPGHSLIEIDGEFKEFLVADESHPQSEEIYR 648 >gb|AFW76727.1| hypothetical protein ZEAMMB73_427029 [Zea mays] Length = 794 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/81 (45%), Positives = 48/81 (59%) Frame = -2 Query: 410 ANKKKWGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYKVLAEIL 231 A+K KWG V+M R++MR++ +KKNPG S +EV+GK HEFL D H SE IY L I Sbjct: 580 ASKSKWGQVKMLRTVMRDRRVKKNPGCSSIEVDGKCHEFLVADVSHVHSEDIYAALGNIY 639 Query: 230 LFPKLDYCTLDGYQNQIDTFL 168 L K + + Y FL Sbjct: 640 LHSKAEGSGVSFYCGPCTQFL 660 >gb|AFW76726.1| hypothetical protein ZEAMMB73_427029 [Zea mays] Length = 646 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/66 (51%), Positives = 44/66 (66%) Frame = -2 Query: 410 ANKKKWGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYKVLAEIL 231 A+K KWG V+M R++MR++ +KKNPG S +EV+GK HEFL D H SE IY L I Sbjct: 580 ASKSKWGQVKMLRTVMRDRRVKKNPGCSSIEVDGKCHEFLVADVSHVHSEDIYAALGNIY 639 Query: 230 LFPKLD 213 L K + Sbjct: 640 LHSKAE 645 >gb|EMT07478.1| hypothetical protein F775_00276 [Aegilops tauschii] Length = 689 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/66 (53%), Positives = 42/66 (63%) Frame = -2 Query: 410 ANKKKWGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYKVLAEIL 231 A +WGDVR R +M EK IKK PG SL+E+ G HEF+AGD HP SE IY L ++L Sbjct: 470 AKSNRWGDVRWLRQVMMEKGIKKEPGCSLIEMNGTIHEFVAGDRSHPMSEEIYSKLDKVL 529 Query: 230 LFPKLD 213 K D Sbjct: 530 TDLKND 535 >gb|EMT07476.1| hypothetical protein F775_15307 [Aegilops tauschii] Length = 696 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/66 (53%), Positives = 42/66 (63%) Frame = -2 Query: 410 ANKKKWGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYKVLAEIL 231 A +WGDVR R +M EK IKK PG SL+E+ G HEF+AGD HP SE IY L +L Sbjct: 538 AKSNRWGDVRWLRQLMMEKGIKKEPGCSLIEMNGTIHEFVAGDRSHPMSEEIYSKLDMLL 597 Query: 230 LFPKLD 213 + K D Sbjct: 598 MDLKND 603 >ref|XP_004963495.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like, partial [Setaria italica] Length = 643 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/66 (50%), Positives = 45/66 (68%) Frame = -2 Query: 410 ANKKKWGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYKVLAEIL 231 A+K KW V+M R++MR++ IKKNPG S ++V+GKFHEFLA D H SE IY L + Sbjct: 572 ASKSKWDQVKMLRTVMRDRGIKKNPGCSSIKVDGKFHEFLAADVSHVHSEDIYTALENVY 631 Query: 230 LFPKLD 213 + K + Sbjct: 632 IHLKTE 637 >ref|XP_003604256.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355505311|gb|AES86453.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 670 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/56 (57%), Positives = 41/56 (73%) Frame = -2 Query: 410 ANKKKWGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYKVL 243 AN KKW +VR R +M+EK I K PGSSL+ V+GK H+F+ GD HPQSE I+ +L Sbjct: 598 ANNKKWAEVRSVRRLMKEKGISKAPGSSLIRVDGKSHKFVVGDNNHPQSEDIHVLL 653 >gb|EXC31089.1| hypothetical protein L484_001076 [Morus notabilis] Length = 625 Score = 70.9 bits (172), Expect = 2e-10 Identities = 36/76 (47%), Positives = 47/76 (61%) Frame = -2 Query: 395 WGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYKVLAEILLFPKL 216 W V R++M+E I+K PG S +EV K HEFLAGD+RHP+S+ IYK+L EI Sbjct: 472 WDGVAKVRTLMKESGIQKEPGCSSIEVNNKIHEFLAGDKRHPKSKQIYKMLEEI-----N 526 Query: 215 DYCTLDGYQNQIDTFL 168 D+ +GY Q D L Sbjct: 527 DWLKANGYTPQTDIVL 542 >ref|XP_006657524.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like [Oryza brachyantha] Length = 395 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/61 (52%), Positives = 44/61 (72%) Frame = -2 Query: 410 ANKKKWGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYKVLAEIL 231 A+ ++W DV M R +M ++ +KK PG S +E++G H+F+AGD HPQSEAIYK L EI Sbjct: 236 ASAQRWNDVGMVRRLMTQEGVKKEPGFSSIEMDGLVHQFVAGDTSHPQSEAIYKKLDEIQ 295 Query: 230 L 228 L Sbjct: 296 L 296 >ref|XP_007143361.1| hypothetical protein PHAVU_007G066000g [Phaseolus vulgaris] gi|561016551|gb|ESW15355.1| hypothetical protein PHAVU_007G066000g [Phaseolus vulgaris] Length = 591 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/56 (55%), Positives = 40/56 (71%) Frame = -2 Query: 410 ANKKKWGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYKVL 243 A KKW DVR R +M++K I K PGSS++ V+G+ HEFL GD HPQSE I+ +L Sbjct: 523 ATNKKWADVRSVRRLMKQKGISKAPGSSIIRVDGRSHEFLVGDNSHPQSENIHVLL 578 >ref|XP_004510744.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010-like, partial [Cicer arietinum] Length = 599 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/56 (55%), Positives = 41/56 (73%) Frame = -2 Query: 410 ANKKKWGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYKVL 243 A KKW +VR R++M+EK I K PGSS++ V+GK H+FL GD HPQSE I+ +L Sbjct: 535 ATNKKWAEVRSVRTLMKEKGISKAPGSSIIRVDGKSHKFLVGDNSHPQSEDIHVLL 590 >ref|NP_001066448.1| Os12g0233200 [Oryza sativa Japonica Group] gi|77553539|gb|ABA96335.1| pentatricopeptide, putative, expressed [Oryza sativa Japonica Group] gi|113648955|dbj|BAF29467.1| Os12g0233200 [Oryza sativa Japonica Group] Length = 704 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/72 (47%), Positives = 43/72 (59%) Frame = -2 Query: 410 ANKKKWGDVRMARSMMREKCIKKNPGSSLVEVEGKFHEFLAGDERHPQSEAIYKVLAEIL 231 A+K KW V+M R MR++ +KKNPG S +EVEGKFH+FL D H SE IY L I Sbjct: 592 ASKNKWDQVKMLRMTMRDRGVKKNPGCSSIEVEGKFHDFLVADVSHACSEEIYSALKNIY 651 Query: 230 LFPKLDYCTLDG 195 K + + G Sbjct: 652 FHLKQEDMSWQG 663