BLASTX nr result
ID: Mentha27_contig00045549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00045549 (420 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007009124.1| Inositol transporter 4 isoform 3 [Theobroma ... 87 2e-15 ref|XP_007009122.1| Inositol transporter 4 isoform 1 [Theobroma ... 87 2e-15 ref|XP_002322517.2| sugar transporter family protein [Populus tr... 87 3e-15 gb|EYU33093.1| hypothetical protein MIMGU_mgv1a003520mg [Mimulus... 86 5e-15 ref|XP_006414343.1| hypothetical protein EUTSA_v10024765mg [Eutr... 86 5e-15 ref|XP_007026272.1| Inositol transporter 4 [Theobroma cacao] gi|... 86 5e-15 ref|XP_006282574.1| hypothetical protein CARUB_v10004447mg [Caps... 86 5e-15 ref|NP_193381.1| inositol transporter 4 [Arabidopsis thaliana] g... 86 5e-15 ref|XP_002870155.1| ATINT4 [Arabidopsis lyrata subsp. lyrata] gi... 86 5e-15 ref|XP_007026283.1| Inositol transporter 4 [Theobroma cacao] gi|... 86 7e-15 ref|XP_004295317.1| PREDICTED: inositol transporter 4-like [Frag... 84 2e-14 ref|XP_004252941.1| PREDICTED: inositol transporter 4-like [Sola... 84 2e-14 ref|XP_002308797.1| sugar transporter family protein [Populus tr... 84 2e-14 gb|EYU27683.1| hypothetical protein MIMGU_mgv1a003465mg [Mimulus... 84 3e-14 ref|XP_006349857.1| PREDICTED: inositol transporter 4-like [Sola... 84 3e-14 gb|EYU45467.1| hypothetical protein MIMGU_mgv1a003509mg [Mimulus... 83 3e-14 ref|XP_007213753.1| hypothetical protein PRUPE_ppa004217m2g, par... 83 5e-14 ref|XP_002267982.1| PREDICTED: inositol transporter 4 isoform 1 ... 82 6e-14 ref|XP_002308798.1| sugar transporter family protein [Populus tr... 82 8e-14 ref|XP_006468182.1| PREDICTED: inositol transporter 4-like [Citr... 82 1e-13 >ref|XP_007009124.1| Inositol transporter 4 isoform 3 [Theobroma cacao] gi|508726037|gb|EOY17934.1| Inositol transporter 4 isoform 3 [Theobroma cacao] Length = 576 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = -2 Query: 353 MVEGGVERVNPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 MVEGGV++ + TEFTECW T+W+TPYIMRLA SAGIGGLLFGYDTG + Sbjct: 1 MVEGGVKKADKTEFTECWKTTWKTPYIMRLALSAGIGGLLFGYDTGVI 48 >ref|XP_007009122.1| Inositol transporter 4 isoform 1 [Theobroma cacao] gi|508726035|gb|EOY17932.1| Inositol transporter 4 isoform 1 [Theobroma cacao] Length = 575 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = -2 Query: 353 MVEGGVERVNPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 MVEGGV++ + TEFTECW T+W+TPYIMRLA SAGIGGLLFGYDTG + Sbjct: 1 MVEGGVKKADKTEFTECWKTTWKTPYIMRLALSAGIGGLLFGYDTGVI 48 >ref|XP_002322517.2| sugar transporter family protein [Populus trichocarpa] gi|550320534|gb|EEF04278.2| sugar transporter family protein [Populus trichocarpa] Length = 579 Score = 86.7 bits (213), Expect = 3e-15 Identities = 38/48 (79%), Positives = 41/48 (85%) Frame = -2 Query: 353 MVEGGVERVNPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 MVEGGV + TEFTECW T W+TPYIMRLAFSAGIGGLLFGYDTG + Sbjct: 1 MVEGGVTTADKTEFTECWKTVWKTPYIMRLAFSAGIGGLLFGYDTGVI 48 >gb|EYU33093.1| hypothetical protein MIMGU_mgv1a003520mg [Mimulus guttatus] Length = 580 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -2 Query: 353 MVEGGVERVNPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 MVEGG+ + + TEFTECW TSW+TPYIMRLA SAG+GGLLFGYDTG + Sbjct: 1 MVEGGIAQADKTEFTECWRTSWKTPYIMRLALSAGLGGLLFGYDTGVI 48 >ref|XP_006414343.1| hypothetical protein EUTSA_v10024765mg [Eutrema salsugineum] gi|557115513|gb|ESQ55796.1| hypothetical protein EUTSA_v10024765mg [Eutrema salsugineum] Length = 581 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -2 Query: 353 MVEGGVERVNPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 MVEGG+ + + TEFTECW T+W+TPYIMRLA SAGIGGLLFGYDTG + Sbjct: 1 MVEGGIAKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGYDTGVI 48 >ref|XP_007026272.1| Inositol transporter 4 [Theobroma cacao] gi|508781638|gb|EOY28894.1| Inositol transporter 4 [Theobroma cacao] Length = 576 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = -2 Query: 353 MVEGGVERVNPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 MVEGGV + + TEF+ECW T+WRTPYIMRLA SAGIGGLLFGYDTG + Sbjct: 1 MVEGGVVKADTTEFSECWKTTWRTPYIMRLALSAGIGGLLFGYDTGVI 48 >ref|XP_006282574.1| hypothetical protein CARUB_v10004447mg [Capsella rubella] gi|482551279|gb|EOA15472.1| hypothetical protein CARUB_v10004447mg [Capsella rubella] Length = 582 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -2 Query: 353 MVEGGVERVNPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 MVEGG+ + + TEFTECW T+W+TPYIMRLA SAGIGGLLFGYDTG + Sbjct: 1 MVEGGIAKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGYDTGVI 48 >ref|NP_193381.1| inositol transporter 4 [Arabidopsis thaliana] gi|75318122|sp|O23492.1|INT4_ARATH RecName: Full=Inositol transporter 4; AltName: Full=Myo-inositol-proton symporter INT4; AltName: Full=Protein INOSITOL TRANSPORTER 4 gi|2245004|emb|CAB10424.1| membrane transporter like protein [Arabidopsis thaliana] gi|7268398|emb|CAB78690.1| membrane transporter like protein [Arabidopsis thaliana] gi|28393478|gb|AAO42160.1| putative membrane transporter [Arabidopsis thaliana] gi|28973605|gb|AAO64127.1| putative membrane transporter [Arabidopsis thaliana] gi|84617973|emb|CAJ00306.1| inositol transporter 4 [Arabidopsis thaliana] gi|332658359|gb|AEE83759.1| inositol transporter 4 [Arabidopsis thaliana] Length = 582 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -2 Query: 353 MVEGGVERVNPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 MVEGG+ + + TEFTECW T+W+TPYIMRLA SAGIGGLLFGYDTG + Sbjct: 1 MVEGGIAKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGYDTGVI 48 >ref|XP_002870155.1| ATINT4 [Arabidopsis lyrata subsp. lyrata] gi|297315991|gb|EFH46414.1| ATINT4 [Arabidopsis lyrata subsp. lyrata] Length = 582 Score = 85.9 bits (211), Expect = 5e-15 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -2 Query: 353 MVEGGVERVNPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 MVEGG+ + + TEFTECW T+W+TPYIMRLA SAGIGGLLFGYDTG + Sbjct: 1 MVEGGIAKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGYDTGVI 48 >ref|XP_007026283.1| Inositol transporter 4 [Theobroma cacao] gi|508781649|gb|EOY28905.1| Inositol transporter 4 [Theobroma cacao] Length = 576 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -2 Query: 353 MVEGGVERVNPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 MVEGGV + + TEFTECW T+W+TPYIM+LA SAGIGGLLFGYDTG + Sbjct: 1 MVEGGVTKADKTEFTECWKTTWKTPYIMKLALSAGIGGLLFGYDTGVI 48 >ref|XP_004295317.1| PREDICTED: inositol transporter 4-like [Fragaria vesca subsp. vesca] Length = 581 Score = 84.3 bits (207), Expect = 2e-14 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = -2 Query: 353 MVEGGVERVNPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 MVEGG + TEFTECW T+WRTPYIMRLA SAGIGGLLFGYDTG + Sbjct: 1 MVEGGAHPSSKTEFTECWKTTWRTPYIMRLALSAGIGGLLFGYDTGVI 48 >ref|XP_004252941.1| PREDICTED: inositol transporter 4-like [Solanum lycopersicum] Length = 580 Score = 84.3 bits (207), Expect = 2e-14 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -2 Query: 353 MVEGGVERVNPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 MVEGG+ + + TEFTECW + WRTPYIM+LAFSAGIGG LFGYDTG + Sbjct: 1 MVEGGISKADKTEFTECWRSVWRTPYIMKLAFSAGIGGFLFGYDTGVI 48 >ref|XP_002308797.1| sugar transporter family protein [Populus trichocarpa] gi|222854773|gb|EEE92320.1| sugar transporter family protein [Populus trichocarpa] Length = 579 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = -2 Query: 353 MVEGGVERVNPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 MVEGGV + TEFTECW T W+TPYIMRLA SAGIGGLLFGYDTG + Sbjct: 1 MVEGGVATADKTEFTECWRTVWKTPYIMRLALSAGIGGLLFGYDTGVI 48 >gb|EYU27683.1| hypothetical protein MIMGU_mgv1a003465mg [Mimulus guttatus] gi|604314978|gb|EYU27684.1| hypothetical protein MIMGU_mgv1a003465mg [Mimulus guttatus] Length = 583 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = -2 Query: 350 VEGGVERVNPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 +EGGV + + TEFTECW TSW+ PYIMRLAFSAGIGGLLFGYDTG + Sbjct: 1 MEGGVTKPDKTEFTECWRTSWKKPYIMRLAFSAGIGGLLFGYDTGVI 47 >ref|XP_006349857.1| PREDICTED: inositol transporter 4-like [Solanum tuberosum] Length = 578 Score = 83.6 bits (205), Expect = 3e-14 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -2 Query: 353 MVEGGVERVNPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 MVEGG+ + + TEFTECWS WRTPYIM+LA SAGIGG LFGYDTG + Sbjct: 1 MVEGGISKADKTEFTECWSAVWRTPYIMKLALSAGIGGFLFGYDTGVI 48 >gb|EYU45467.1| hypothetical protein MIMGU_mgv1a003509mg [Mimulus guttatus] Length = 580 Score = 83.2 bits (204), Expect = 3e-14 Identities = 36/48 (75%), Positives = 40/48 (83%) Frame = -2 Query: 353 MVEGGVERVNPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 MVE + R + TEFTECW TSW+TPYIMRLA SAGIGGLLFGYDTG + Sbjct: 1 MVESRISRTDKTEFTECWRTSWKTPYIMRLALSAGIGGLLFGYDTGVI 48 >ref|XP_007213753.1| hypothetical protein PRUPE_ppa004217m2g, partial [Prunus persica] gi|462409618|gb|EMJ14952.1| hypothetical protein PRUPE_ppa004217m2g, partial [Prunus persica] Length = 317 Score = 82.8 bits (203), Expect = 5e-14 Identities = 36/48 (75%), Positives = 40/48 (83%) Frame = -2 Query: 353 MVEGGVERVNPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 MVEGG + TEFTECW T+W+TPYIMRLA SAGIGGLLFGYDTG + Sbjct: 1 MVEGGAHPSSKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGYDTGVI 48 >ref|XP_002267982.1| PREDICTED: inositol transporter 4 isoform 1 [Vitis vinifera] gi|302141645|emb|CBI18776.3| unnamed protein product [Vitis vinifera] gi|310877900|gb|ADP37181.1| putative inositol transporter [Vitis vinifera] Length = 585 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -2 Query: 353 MVEGGVERVNPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 MVEGG+ + + EFTECW T W+TPYIMRLA SAGIGGLLFGYDTG + Sbjct: 1 MVEGGIIKADKVEFTECWQTIWKTPYIMRLALSAGIGGLLFGYDTGVI 48 >ref|XP_002308798.1| sugar transporter family protein [Populus trichocarpa] gi|222854774|gb|EEE92321.1| sugar transporter family protein [Populus trichocarpa] Length = 576 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/49 (75%), Positives = 42/49 (85%), Gaps = 1/49 (2%) Frame = -2 Query: 353 MVEGGVERV-NPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 MVEGGV + + TEFTECW +W+TPYIMRLAFSAGIGGLLFGYDTG + Sbjct: 1 MVEGGVVKAADKTEFTECWKVTWKTPYIMRLAFSAGIGGLLFGYDTGVI 49 >ref|XP_006468182.1| PREDICTED: inositol transporter 4-like [Citrus sinensis] Length = 631 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -2 Query: 353 MVEGGVERVNPTEFTECWSTSWRTPYIMRLAFSAGIGGLLFGYDTGTL 210 MVEGGV + + TEFTECW+ W TPYIM+LA SAGIGGLLFGYDTG + Sbjct: 1 MVEGGVSKASKTEFTECWNIVWTTPYIMKLALSAGIGGLLFGYDTGVI 48