BLASTX nr result
ID: Mentha27_contig00045341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00045341 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007211336.1| hypothetical protein PRUPE_ppa025235mg, part... 60 3e-07 >ref|XP_007211336.1| hypothetical protein PRUPE_ppa025235mg, partial [Prunus persica] gi|462407201|gb|EMJ12535.1| hypothetical protein PRUPE_ppa025235mg, partial [Prunus persica] Length = 943 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/62 (50%), Positives = 39/62 (62%), Gaps = 3/62 (4%) Frame = -1 Query: 205 PIQPPVVKVKVGRPQKERR-KDGN--DRKDCTKLSRIGHKKTCSKCFGEGHNFRTCKNEI 35 P+ PP+VK + GRP+K R KD KD TKL + G KTC+KC+ GHN TCKN+ Sbjct: 800 PVLPPIVKKQPGRPKKRRIIKDSEMEKNKDPTKLGKKGGTKTCTKCWERGHNRTTCKNQP 859 Query: 34 HE 29 E Sbjct: 860 RE 861