BLASTX nr result
ID: Mentha27_contig00045169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00045169 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17761.1| hypothetical protein MIMGU_mgv1a000811mg [Mimulus... 60 3e-07 >gb|EYU17761.1| hypothetical protein MIMGU_mgv1a000811mg [Mimulus guttatus] gi|604297549|gb|EYU17762.1| hypothetical protein MIMGU_mgv1a000811mg [Mimulus guttatus] Length = 977 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/61 (50%), Positives = 43/61 (70%), Gaps = 2/61 (3%) Frame = +2 Query: 2 RETASILETQIRDAIYQAQDAIEDFISRRTASFS--FPEITQKIDPIAAQAKELADSIRK 175 R+ ++L+ IRDA+Y+AQD IE FI +RT S EI IDP+AA+AK++A SI+K Sbjct: 53 RQQVNVLDGNIRDAVYKAQDEIESFIIKRTLSSESFLQEIIAVIDPLAAEAKKIASSIKK 112 Query: 176 E 178 E Sbjct: 113 E 113