BLASTX nr result
ID: Mentha27_contig00045162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00045162 (269 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001911789.1| hypothetical protein [Podospora anserina S m... 74 2e-11 gb|ENH82025.1| mitochondrial protein sorting protein [Colletotri... 74 3e-11 gb|EPE08307.1| protein msf1 [Ophiostoma piceae UAMH 11346] 73 4e-11 gb|EGY19825.1| MSF1 protein [Verticillium dahliae VdLs.17] 73 4e-11 gb|EFX04358.1| mitochondrial protein sorting [Grosmannia clavige... 73 4e-11 ref|XP_003007521.1| MSF1 [Verticillium alfalfae VaMs.102] gi|261... 73 4e-11 gb|EGO60254.1| hypothetical protein NEUTE1DRAFT_127175 [Neurospo... 73 5e-11 ref|XP_960953.1| protein MSF1 [Neurospora crassa OR74A] gi|28922... 73 5e-11 ref|XP_007277342.1| mitochondrial protein sorting [Colletotrichu... 72 6e-11 gb|EFQ35078.1| PRELI-like family protein [Colletotrichum gramini... 72 8e-11 ref|XP_007598211.1| PRELI-like family protein [Colletotrichum fi... 72 1e-10 gb|EMR62913.1| putative protein msf1 protein [Eutypa lata UCREL1] 72 1e-10 gb|EJT80661.1| MSF1 domain-containing protein [Gaeumannomyces gr... 72 1e-10 emb|CCF36633.1| PRELI-like family protein [Colletotrichum higgin... 72 1e-10 gb|ERT02957.1| hypothetical protein HMPREF1624_01261 [Sporothrix... 71 1e-10 ref|XP_752232.1| mitochondrial protein sorting (Msf1) [Aspergill... 71 2e-10 ref|XP_001821492.1| protein MSF1 [Aspergillus oryzae RIB40] gi|2... 71 2e-10 ref|XP_007292993.1| PRELI-like family protein [Marssonina brunne... 71 2e-10 ref|XP_003649873.1| hypothetical protein THITE_2108933 [Thielavi... 71 2e-10 ref|XP_003349296.1| hypothetical protein SMAC_05579 [Sordaria ma... 71 2e-10 >ref|XP_001911789.1| hypothetical protein [Podospora anserina S mat+] gi|170946813|emb|CAP73617.1| unnamed protein product [Podospora anserina S mat+] Length = 198 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFSNT TFNYSWEEVSTANWRKYCPWNDKS Sbjct: 1 MKVFSNTETFNYSWEEVSTANWRKYCPWNDKS 32 >gb|ENH82025.1| mitochondrial protein sorting protein [Colletotrichum orbiculare MAFF 240422] Length = 191 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFSN VTFNYSWEEVSTANWRKYCPWNDK+ Sbjct: 1 MKVFSNAVTFNYSWEEVSTANWRKYCPWNDKA 32 >gb|EPE08307.1| protein msf1 [Ophiostoma piceae UAMH 11346] Length = 221 Score = 73.2 bits (178), Expect = 4e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFSNTVTF+YSWEEVSTANWRKYCPWN+KS Sbjct: 1 MKVFSNTVTFDYSWEEVSTANWRKYCPWNEKS 32 >gb|EGY19825.1| MSF1 protein [Verticillium dahliae VdLs.17] Length = 192 Score = 73.2 bits (178), Expect = 4e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFSN+VTFNYSWEEVSTANW KYCPWNDKS Sbjct: 1 MKVFSNSVTFNYSWEEVSTANWNKYCPWNDKS 32 >gb|EFX04358.1| mitochondrial protein sorting [Grosmannia clavigera kw1407] Length = 230 Score = 73.2 bits (178), Expect = 4e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFSN+VTF+YSWEEVSTANWRKYCPWNDKS Sbjct: 1 MKVFSNSVTFDYSWEEVSTANWRKYCPWNDKS 32 >ref|XP_003007521.1| MSF1 [Verticillium alfalfae VaMs.102] gi|261353172|gb|EEY15600.1| MSF1 [Verticillium alfalfae VaMs.102] Length = 192 Score = 73.2 bits (178), Expect = 4e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFSN+VTFNYSWEEVSTANW KYCPWNDKS Sbjct: 1 MKVFSNSVTFNYSWEEVSTANWNKYCPWNDKS 32 >gb|EGO60254.1| hypothetical protein NEUTE1DRAFT_127175 [Neurospora tetrasperma FGSC 2508] gi|350294699|gb|EGZ75784.1| hypothetical protein NEUTE2DRAFT_105989 [Neurospora tetrasperma FGSC 2509] Length = 198 Score = 72.8 bits (177), Expect = 5e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFSNT TFNYSWEEVSTANWRKYCPWN+KS Sbjct: 1 MKVFSNTETFNYSWEEVSTANWRKYCPWNEKS 32 >ref|XP_960953.1| protein MSF1 [Neurospora crassa OR74A] gi|28922487|gb|EAA31717.1| MSF1 [Neurospora crassa OR74A] gi|28950168|emb|CAD71036.1| probable protein involved in intramitochondrial protein sorting [Neurospora crassa] Length = 198 Score = 72.8 bits (177), Expect = 5e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFSNT TFNYSWEEVSTANWRKYCPWN+KS Sbjct: 1 MKVFSNTETFNYSWEEVSTANWRKYCPWNEKS 32 >ref|XP_007277342.1| mitochondrial protein sorting [Colletotrichum gloeosporioides Nara gc5] gi|429858807|gb|ELA33614.1| mitochondrial protein sorting [Colletotrichum gloeosporioides Nara gc5] gi|530475726|gb|EQB55748.1| PRELI-like family protein [Colletotrichum gloeosporioides Cg-14] Length = 189 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFSN VTF YSWEEVSTANWRKYCPWNDKS Sbjct: 1 MKVFSNAVTFEYSWEEVSTANWRKYCPWNDKS 32 >gb|EFQ35078.1| PRELI-like family protein [Colletotrichum graminicola M1.001] Length = 196 Score = 72.0 bits (175), Expect = 8e-11 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFSN+VTFNYSWEEVS ANWRKYCPWNDK+ Sbjct: 1 MKVFSNSVTFNYSWEEVSAANWRKYCPWNDKT 32 >ref|XP_007598211.1| PRELI-like family protein [Colletotrichum fioriniae PJ7] gi|588896693|gb|EXF78121.1| PRELI-like family protein [Colletotrichum fioriniae PJ7] Length = 195 Score = 71.6 bits (174), Expect = 1e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFSN VTFNYSWEEVS ANWRKYCPWNDK+ Sbjct: 1 MKVFSNAVTFNYSWEEVSAANWRKYCPWNDKT 32 >gb|EMR62913.1| putative protein msf1 protein [Eutypa lata UCREL1] Length = 192 Score = 71.6 bits (174), Expect = 1e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFSNT TFNYSW+EVS ANWRKYCPWNDKS Sbjct: 1 MKVFSNTCTFNYSWDEVSAANWRKYCPWNDKS 32 >gb|EJT80661.1| MSF1 domain-containing protein [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 187 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFSNT TFNYSWEEVSTANW KYCPWNDKS Sbjct: 1 MKVFSNTETFNYSWEEVSTANWLKYCPWNDKS 32 >emb|CCF36633.1| PRELI-like family protein [Colletotrichum higginsianum] Length = 196 Score = 71.6 bits (174), Expect = 1e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFSN VTFNYSWEEVS ANWRKYCPWNDK+ Sbjct: 1 MKVFSNAVTFNYSWEEVSAANWRKYCPWNDKT 32 >gb|ERT02957.1| hypothetical protein HMPREF1624_01261 [Sporothrix schenckii ATCC 58251] Length = 219 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFSNT TF+YSWEEVSTANWRKYCPWN+KS Sbjct: 1 MKVFSNTCTFDYSWEEVSTANWRKYCPWNEKS 32 >ref|XP_752232.1| mitochondrial protein sorting (Msf1) [Aspergillus fumigatus Af293] gi|66849866|gb|EAL90194.1| mitochondrial protein sorting (Msf1), putative [Aspergillus fumigatus Af293] gi|159124853|gb|EDP49970.1| mitochondrial protein sorting (Msf1), putative [Aspergillus fumigatus A1163] Length = 190 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFS+T TF+YSWEEVSTANWRKYCPWNDKS Sbjct: 1 MKVFSSTCTFDYSWEEVSTANWRKYCPWNDKS 32 >ref|XP_001821492.1| protein MSF1 [Aspergillus oryzae RIB40] gi|238492078|ref|XP_002377276.1| mitochondrial protein sorting (Msf1), putative [Aspergillus flavus NRRL3357] gi|83769353|dbj|BAE59490.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220697689|gb|EED54030.1| mitochondrial protein sorting (Msf1), putative [Aspergillus flavus NRRL3357] gi|391869054|gb|EIT78259.1| putative member of the intrasorting protein family [Aspergillus oryzae 3.042] Length = 190 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFS+T TF+YSWEEVSTANWRKYCPWNDKS Sbjct: 1 MKVFSSTCTFDYSWEEVSTANWRKYCPWNDKS 32 >ref|XP_007292993.1| PRELI-like family protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406863588|gb|EKD16635.1| PRELI-like family protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 189 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFSN TFNYSWEEVSTANWRKYCPWND+S Sbjct: 1 MKVFSNDCTFNYSWEEVSTANWRKYCPWNDQS 32 >ref|XP_003649873.1| hypothetical protein THITE_2108933 [Thielavia terrestris NRRL 8126] gi|346997134|gb|AEO63537.1| hypothetical protein THITE_2108933 [Thielavia terrestris NRRL 8126] Length = 200 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFSNT TFNYSW+EVSTANWRKYCPWN KS Sbjct: 1 MKVFSNTETFNYSWDEVSTANWRKYCPWNQKS 32 >ref|XP_003349296.1| hypothetical protein SMAC_05579 [Sordaria macrospora k-hell] gi|380089869|emb|CCC12402.1| unnamed protein product [Sordaria macrospora k-hell] Length = 198 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 170 MKVFSNTVTFNYSWEEVSTANWRKYCPWNDKS 265 MKVFSNT TFNYSWEEVS ANWRKYCPWN+KS Sbjct: 1 MKVFSNTETFNYSWEEVSAANWRKYCPWNEKS 32