BLASTX nr result
ID: Mentha27_contig00044924
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00044924 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44084.1| hypothetical protein MIMGU_mgv11b018458mg, partia... 56 6e-06 gb|EYU26073.1| hypothetical protein MIMGU_mgv1a024939mg, partial... 55 8e-06 >gb|EYU44084.1| hypothetical protein MIMGU_mgv11b018458mg, partial [Mimulus guttatus] Length = 158 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/57 (43%), Positives = 40/57 (70%) Frame = +2 Query: 2 NRRQGVVFKEFCTVRYSDRSMYAILSDVYLIRGRSTENVSNPDQFRGNLRSLLEELR 172 NR+Q +++K+ CT+RYSD ++ + +D Y + GR+ S+PDQF+ NLR L+ LR Sbjct: 85 NRKQAILWKDTCTLRYSDEPIFGVRADGYFVMGRA-GTFSSPDQFKQNLRVLVNGLR 140 >gb|EYU26073.1| hypothetical protein MIMGU_mgv1a024939mg, partial [Mimulus guttatus] Length = 173 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/57 (43%), Positives = 40/57 (70%) Frame = +2 Query: 2 NRRQGVVFKEFCTVRYSDRSMYAILSDVYLIRGRSTENVSNPDQFRGNLRSLLEELR 172 NR+Q +++K+ CT+RYSD ++ + +D Y + GR+ S+PDQF+ NLR L+ LR Sbjct: 81 NRKQSILWKDTCTLRYSDEPIFGVRADGYFVMGRAGA-FSSPDQFKQNLRVLVNGLR 136