BLASTX nr result
ID: Mentha27_contig00044795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00044795 (506 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCF40478.1| hypothetical protein CH063_11035 [Colletotrichum... 74 2e-11 gb|EQB46487.1| hypothetical protein CGLO_14460 [Colletotrichum g... 73 4e-11 ref|XP_007275811.1| hypothetical protein CGGC5_5089 [Colletotric... 72 6e-11 >emb|CCF40478.1| hypothetical protein CH063_11035 [Colletotrichum higginsianum] Length = 79 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/81 (41%), Positives = 49/81 (60%), Gaps = 2/81 (2%) Frame = +1 Query: 70 MKFTAIASGLILVLPTSVLAQNYFCTERGFNTALQCGN-KYQFCC-LLDEQRDEFQIWRP 243 MKF ++ + + L+ P +CT G +T CG+ ++QFCC + ++ I+R Sbjct: 1 MKFFSLVASVALLTPA---VHGAWCTSYGISTKFACGSGRFQFCCDAPNSPAGDYNIFRG 57 Query: 244 GCTRPAGNERNCGDGGYISCC 306 CTRP GN RNCGDGGY+SCC Sbjct: 58 DCTRPEGNTRNCGDGGYVSCC 78 >gb|EQB46487.1| hypothetical protein CGLO_14460 [Colletotrichum gloeosporioides Cg-14] Length = 79 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/81 (45%), Positives = 49/81 (60%), Gaps = 2/81 (2%) Frame = +1 Query: 70 MKFTAIASGLILVLPTSVLAQNYFCTERGFNTALQC-GNKYQFCC-LLDEQRDEFQIWRP 243 MKF ++ L+L PT A +CT G +T C + QFCC + ++ I+R Sbjct: 1 MKFFSVVCTLVLSAPTVYGA---WCTSYGISTRFGCESGRNQFCCDVPGAPVSDYNIFRG 57 Query: 244 GCTRPAGNERNCGDGGYISCC 306 CTRPAGN+RNCGDGGY+SCC Sbjct: 58 DCTRPAGNQRNCGDGGYVSCC 78 >ref|XP_007275811.1| hypothetical protein CGGC5_5089 [Colletotrichum gloeosporioides Nara gc5] gi|429860437|gb|ELA35176.1| hypothetical protein CGGC5_5089 [Colletotrichum gloeosporioides Nara gc5] Length = 79 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/81 (45%), Positives = 46/81 (56%), Gaps = 2/81 (2%) Frame = +1 Query: 70 MKFTAIASGLILVLPTSVLAQNYFCTERGFNTALQC-GNKYQFCC-LLDEQRDEFQIWRP 243 MKF + L L PT +CT G +T C + QFCC + ++ I+R Sbjct: 1 MKFFGVVLTLALSAPT---VYGSWCTSYGISTRFGCESGRNQFCCDVPGAPVSDYNIYRG 57 Query: 244 GCTRPAGNERNCGDGGYISCC 306 CTRPAGNERNCGDGGY+SCC Sbjct: 58 DCTRPAGNERNCGDGGYVSCC 78