BLASTX nr result
ID: Mentha27_contig00044428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00044428 (207 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006489539.1| PREDICTED: MATH domain-containing protein At... 57 3e-06 ref|XP_006420151.1| hypothetical protein CICLE_v10004192mg [Citr... 57 3e-06 ref|XP_006606359.1| PREDICTED: MATH domain-containing protein At... 55 8e-06 ref|XP_006606358.1| PREDICTED: MATH domain-containing protein At... 55 8e-06 >ref|XP_006489539.1| PREDICTED: MATH domain-containing protein At5g43560-like [Citrus sinensis] Length = 1133 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 192 GRSFEGVSTGQQQPRCQSGEALAEWRSSEQVENG 91 GRS EG+S+GQ RCQSGEALAEWRSSEQVENG Sbjct: 12 GRSVEGISSGQ---RCQSGEALAEWRSSEQVENG 42 >ref|XP_006420151.1| hypothetical protein CICLE_v10004192mg [Citrus clementina] gi|567854065|ref|XP_006420152.1| hypothetical protein CICLE_v10004192mg [Citrus clementina] gi|567854067|ref|XP_006420153.1| hypothetical protein CICLE_v10004192mg [Citrus clementina] gi|567854069|ref|XP_006420154.1| hypothetical protein CICLE_v10004192mg [Citrus clementina] gi|557522024|gb|ESR33391.1| hypothetical protein CICLE_v10004192mg [Citrus clementina] gi|557522025|gb|ESR33392.1| hypothetical protein CICLE_v10004192mg [Citrus clementina] gi|557522026|gb|ESR33393.1| hypothetical protein CICLE_v10004192mg [Citrus clementina] gi|557522027|gb|ESR33394.1| hypothetical protein CICLE_v10004192mg [Citrus clementina] Length = 1133 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 192 GRSFEGVSTGQQQPRCQSGEALAEWRSSEQVENG 91 GRS EG+S+GQ RCQSGEALAEWRSSEQVENG Sbjct: 12 GRSVEGISSGQ---RCQSGEALAEWRSSEQVENG 42 >ref|XP_006606359.1| PREDICTED: MATH domain-containing protein At5g43560-like isoform X2 [Glycine max] Length = 712 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 192 GRSFEGVSTGQQQPRCQSGEALAEWRSSEQVENG 91 G+S EG+S GQ RCQSGEALAEWRSSEQVENG Sbjct: 12 GKSVEGISNGQ---RCQSGEALAEWRSSEQVENG 42 >ref|XP_006606358.1| PREDICTED: MATH domain-containing protein At5g43560-like isoform X1 [Glycine max] Length = 1140 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 192 GRSFEGVSTGQQQPRCQSGEALAEWRSSEQVENG 91 G+S EG+S GQ RCQSGEALAEWRSSEQVENG Sbjct: 12 GKSVEGISNGQ---RCQSGEALAEWRSSEQVENG 42