BLASTX nr result
ID: Mentha27_contig00044300
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00044300 (467 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46144.1| hypothetical protein MIMGU_mgv1a0183232mg, partia... 66 4e-09 >gb|EYU46144.1| hypothetical protein MIMGU_mgv1a0183232mg, partial [Mimulus guttatus] Length = 133 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 99 CTSRHFSWLMKSCFPNPQHPHLPSYLSPTTAAA 1 CTSRHFSWLMKSCF NPQHPHLPS LS TAAA Sbjct: 14 CTSRHFSWLMKSCFTNPQHPHLPSPLSSITAAA 46