BLASTX nr result
ID: Mentha27_contig00044126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00044126 (233 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB55318.1| conserved hypothetical protein [Asparagus officin... 57 2e-06 >gb|ABB55318.1| conserved hypothetical protein [Asparagus officinalis] Length = 324 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/56 (50%), Positives = 37/56 (66%) Frame = +2 Query: 2 EAMEVPPPPNDIIIEESEPTMHENFLARIKKIKDKTAHGVLQNALIEHLWEEYSYS 169 E E P P D++++E+ T F+ R KIKDK AH L+NALI+HLWEEY+ S Sbjct: 269 EVREAPTPEVDMVVDET--TRFGQFITRYGKIKDKDAHIALRNALIDHLWEEYTNS 322