BLASTX nr result
ID: Mentha27_contig00044090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00044090 (294 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41852.1| hypothetical protein MIMGU_mgv1a020064mg, partial... 51 8e-07 >gb|EYU41852.1| hypothetical protein MIMGU_mgv1a020064mg, partial [Mimulus guttatus] Length = 367 Score = 50.8 bits (120), Expect(2) = 8e-07 Identities = 23/44 (52%), Positives = 33/44 (75%) Frame = +1 Query: 61 QSLKSLHLECLKVSGEDVELFVCNCPSLEKLMIRYVSLTSDTGV 192 +SLK+L L+C+ V+GE +E F+ NCPSLEKL++ Y S S+ V Sbjct: 178 KSLKALSLKCVNVTGEAIEFFLRNCPSLEKLVVTYTSKLSNLEV 221 Score = 27.7 bits (60), Expect(2) = 8e-07 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 201 KSIKVSAPSLAFIRFHEEEVGKLLFENVPRL 293 KS+KVSAP+L I +V LL ENVP L Sbjct: 240 KSVKVSAPNL--ISLTVPKVEGLLLENVPAL 268