BLASTX nr result
ID: Mentha27_contig00044045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00044045 (196 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26167.1| hypothetical protein MIMGU_mgv1a003623mg [Mimulus... 70 4e-10 >gb|EYU26167.1| hypothetical protein MIMGU_mgv1a003623mg [Mimulus guttatus] Length = 573 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/58 (56%), Positives = 43/58 (74%) Frame = -3 Query: 182 FKRILERLSSSPAMSVDIILSRLSPNGNTFLHVAATHGNQGVVNFIATMKPSLLLAKN 9 F R L R+S++ + V +IL RLSP+GNTFLH+AA HGN+ VV +IA PSL+L KN Sbjct: 61 FSRTLHRVSTAERVPVGVILHRLSPSGNTFLHIAAKHGNEQVVAYIAAKDPSLMLIKN 118