BLASTX nr result
ID: Mentha27_contig00043653
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00043653 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24627.1| hypothetical protein MIMGU_mgv1a005651mg [Mimulus... 56 6e-06 >gb|EYU24627.1| hypothetical protein MIMGU_mgv1a005651mg [Mimulus guttatus] Length = 475 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -2 Query: 104 MDSNYSKLDVKDENFQLKTQAFRLISPDHDNGY 6 MDSNY+KL+VKD +FQ KT + RLISPDH+NGY Sbjct: 1 MDSNYAKLEVKDGSFQSKTSSLRLISPDHENGY 33