BLASTX nr result
ID: Mentha27_contig00043565
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00043565 (306 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003590438.1| hypothetical protein MTR_1g062150 [Medicago ... 59 9e-07 ref|XP_003635790.1| Receptor-like kinase [Medicago truncatula] g... 57 3e-06 emb|CCA66222.1| hypothetical protein [Beta vulgaris subsp. vulga... 57 3e-06 emb|CCA66198.1| hypothetical protein [Beta vulgaris subsp. vulga... 55 8e-06 >ref|XP_003590438.1| hypothetical protein MTR_1g062150 [Medicago truncatula] gi|355479486|gb|AES60689.1| hypothetical protein MTR_1g062150 [Medicago truncatula] Length = 129 Score = 58.5 bits (140), Expect = 9e-07 Identities = 36/99 (36%), Positives = 49/99 (49%), Gaps = 2/99 (2%) Frame = +1 Query: 16 KRYLVWEG*WLGDSSLKDRFPRLFHLNQGAKVC--DMGL*VQGEWS*AIPWRMELRERDE 189 K W W+G S ++RF RLF L+ +V DM GE A+ WR L +E Sbjct: 26 KHIYFWSDAWVGGVSFRERFSRLFELSMSKRVSVFDMFQLGWGENGEALKWRQRLFAWEE 85 Query: 190 EGAAELYELLQQFSLTVGRVDMWQWKGMGADGFSVRKAY 306 + EL LLQ +L V D+W W ++ +SVR AY Sbjct: 86 KQVEELCLLLQNVTLQVDNEDIWLWTLEKSNVYSVRSAY 124 >ref|XP_003635790.1| Receptor-like kinase [Medicago truncatula] gi|355501725|gb|AES82928.1| Receptor-like kinase [Medicago truncatula] Length = 2313 Score = 57.0 bits (136), Expect = 3e-06 Identities = 35/96 (36%), Positives = 46/96 (47%), Gaps = 2/96 (2%) Frame = +1 Query: 25 LVWEG*WLGDSSLKDRFPRLFHL--NQGAKVCDMGL*VQGEWS*AIPWRMELRERDEEGA 198 L W W+G+S L+ ++PRLF L N+ V DM + WR L +EE Sbjct: 1480 LFWHDHWVGESPLRYKYPRLFDLAVNKDCTVADMERDGWEDEGGVWVWRRRLLAWEEESV 1539 Query: 199 AELYELLQQFSLTVGRVDMWQWKGMGADGFSVRKAY 306 E LL F L V D W+W G+SVR+AY Sbjct: 1540 RECSLLLHNFVLQVNIFDKWRWTLDTVHGYSVREAY 1575 >emb|CCA66222.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1383 Score = 56.6 bits (135), Expect = 3e-06 Identities = 33/93 (35%), Positives = 47/93 (50%), Gaps = 2/93 (2%) Frame = +1 Query: 31 WEG*WLGDSSLKDRFPRLFHL--NQGAKVCDMGL*VQGEWS*AIPWRMELRERDEEGAAE 204 W+ W+G+ LK FPRL+ L N A + +G+ EW +PW+ LR RD E Sbjct: 939 WQEIWIGELPLKTLFPRLYRLTINPLATISSLGIWDGHEWHWVLPWQRALRPRDIEERDA 998 Query: 205 LYELLQQFSLTVGRVDMWQWKGMGADGFSVRKA 303 L+ELL+ L + D W + FSV+ A Sbjct: 999 LHELLKDVVLDLTNDDYLVWTPNKSGVFSVKSA 1031 >emb|CCA66198.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1381 Score = 55.5 bits (132), Expect = 8e-06 Identities = 34/94 (36%), Positives = 47/94 (50%), Gaps = 2/94 (2%) Frame = +1 Query: 31 WEG*WLGDSSLKDRFPRLFHLNQG--AKVCDMGL*VQGEWS*AIPWRMELRERDEEGAAE 204 W W+ +S+LK +FPRLF + + A V MG EW IPW ELR RD+ Sbjct: 939 WHDIWIDNSALKFQFPRLFLIAEQPLAVVSSMGQFQGNEWRWLIPWSRELRSRDQVEWET 998 Query: 205 LYELLQQFSLTVGRVDMWQWKGMGADGFSVRKAY 306 L LLQ ++ D+ W+ + FSV+ Y Sbjct: 999 LCSLLQNIKISKEGEDVLIWRHDKSGIFSVKSFY 1032