BLASTX nr result
ID: Mentha27_contig00043320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00043320 (269 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17690.1| hypothetical protein MIMGU_mgv1a023002mg [Mimulus... 61 2e-07 gb|EYU23538.1| hypothetical protein MIMGU_mgv1a020112mg, partial... 58 1e-06 >gb|EYU17690.1| hypothetical protein MIMGU_mgv1a023002mg [Mimulus guttatus] Length = 908 Score = 60.8 bits (146), Expect = 2e-07 Identities = 37/101 (36%), Positives = 58/101 (57%), Gaps = 12/101 (11%) Frame = +2 Query: 2 LLNSSRTSIAASTQKILKIALQRAKKLQETLEKFDDIR-NNSEGVTSVEARVRDEARNLE 178 LLNSS+ S+ ++K +K A + + LQE L++FD + NN+E V +++ + ++ R E Sbjct: 16 LLNSSQISLVPPSKKFIKSAYKHVQSLQEALKRFDSCKNNNNERVNALDDEIGEKVRKFE 75 Query: 179 DAIESHASAQF-----QSHTTN------TTLSLNPDHLKNE 268 D IESH S QF QSH + + LS+ + LK E Sbjct: 76 DLIESHLSNQFLSQYEQSHDEDHEISHPSILSVETEELKQE 116 >gb|EYU23538.1| hypothetical protein MIMGU_mgv1a020112mg, partial [Mimulus guttatus] Length = 225 Score = 58.2 bits (139), Expect = 1e-06 Identities = 38/95 (40%), Positives = 54/95 (56%), Gaps = 6/95 (6%) Frame = +2 Query: 2 LLNSSRTSIAASTQKILKIALQRAKKLQETLEKFDDI-RNNSEGVTSVEARVRDEARNLE 178 LL SS S ++KILK + ++ LQE L++FD+ R +SE V +++ +R+ R LE Sbjct: 16 LLKSSEISFVPPSKKILKSSYKQLLSLQEVLKRFDNSSRISSERVNALDGEIREVVRKLE 75 Query: 179 DAIESHASAQFQS-----HTTNTTLSLNPDHLKNE 268 D IES S QF S H LSL+ +KNE Sbjct: 76 DVIESRVSNQFLSQSGEIHPLLLVLSLDMVEVKNE 110