BLASTX nr result
ID: Mentha27_contig00043214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00043214 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29980.1| hypothetical protein MIMGU_mgv1a025609mg [Mimulus... 77 3e-12 gb|EYU26769.1| hypothetical protein MIMGU_mgv1a025569mg [Mimulus... 72 8e-11 >gb|EYU29980.1| hypothetical protein MIMGU_mgv1a025609mg [Mimulus guttatus] Length = 109 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/52 (71%), Positives = 42/52 (80%), Gaps = 4/52 (7%) Frame = -2 Query: 166 PHPPPA---KNQTQIFRDFFAARISGLNTT-KNGTFLDNKRRIPSCPDPLHN 23 P PPP+ KNQT+IFR++F R+S LNTT KNGTFLD KR IPSCPDPLHN Sbjct: 58 PPPPPSPAGKNQTEIFREYFKGRVSDLNTTTKNGTFLDYKRSIPSCPDPLHN 109 >gb|EYU26769.1| hypothetical protein MIMGU_mgv1a025569mg [Mimulus guttatus] Length = 113 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/48 (66%), Positives = 40/48 (83%), Gaps = 2/48 (4%) Frame = -2 Query: 160 PPPAKN--QTQIFRDFFAARISGLNTTKNGTFLDNKRRIPSCPDPLHN 23 PP KN QT++F+D+F +RIS LN+T NGTF+D+KRRIPSCPD LHN Sbjct: 66 PPAGKNNNQTEVFKDYFYSRISDLNSTTNGTFVDSKRRIPSCPDALHN 113