BLASTX nr result
ID: Mentha27_contig00042669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00042669 (231 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_002542969.1| hypothetical protein [Propionibacterium acne... 100 2e-19 ref|YP_005415574.1| hypothetical protein RSPPHO_03265, partial [... 73 4e-11 emb|CDN41090.1| hypothetical protein BN871_AB_00880 [Paenibacill... 72 6e-11 ref|YP_001680916.1| hypothetical protein HM1_3147 [Heliobacteriu... 69 5e-10 ref|WP_016520404.1| hypothetical protein, partial [Treponema soc... 69 9e-10 gb|ETI87245.1| hypothetical protein Q615_SPAC00010G0001 [Strepto... 66 6e-09 ref|WP_006588044.1| permease [Lactobacillus jensenii] gi|2388322... 66 6e-09 gb|ABP91180.1| unknown protein [Streptococcus suis 98HAH33] gi|1... 65 8e-09 ref|YP_003602124.1| pg1 protein, homology to Homo sapiens [Lacto... 65 1e-08 ref|YP_003600533.1| pg1 protein, homology to Homo sapiens [Lacto... 65 1e-08 ref|WP_022187435.1| putative uncharacterized protein [Azospirill... 64 2e-08 ref|WP_006586439.1| hypothetical protein, partial [Lactobacillus... 62 8e-08 emb|CBY13234.1| unnamed protein product [Oikopleura dioica] 61 1e-07 ref|WP_023269490.1| hypothetical protein [Propionibacterium acne... 60 3e-07 ref|WP_018392648.1| hypothetical protein [Bacillus sp. 37MA] 58 1e-06 ref|WP_006547558.1| hypothetical protein [Actinomyces coleocanis... 58 1e-06 ref|WP_001330868.1| hypothetical protein, partial [Escherichia c... 57 2e-06 ref|WP_001335213.1| hypothetical protein [Enterobacteriaceae] gi... 57 2e-06 ref|WP_006785033.1| hypothetical protein [Turicibacter sanguinis... 57 2e-06 gb|AHU34758.1| membrane protein, partial [Salmonella enterica su... 57 3e-06 >ref|WP_002542969.1| hypothetical protein [Propionibacterium acnes] gi|315078257|gb|EFT50296.1| hypothetical protein HMPREF9565_01483 [Propionibacterium acnes HL053PA2] Length = 113 Score = 100 bits (249), Expect = 2e-19 Identities = 47/76 (61%), Positives = 52/76 (68%) Frame = -3 Query: 229 SSPPVSKAGSGLSPEFSLPT*RTAYELFTPNNSGQRLHPTYYRGCWHVVSRCFFCRYRHL 50 SS PVSKA SGLSP+ +LPT T YE FTPN SGQR HPTY+RGCWHVVSRCFF YRH Sbjct: 17 SSQPVSKARSGLSPKITLPTRSTTYEPFTPNKSGQRSHPTYHRGCWHVVSRCFFTHYRHS 76 Query: 49 TLLPCRKVYNPKASIP 2 + P+ P Sbjct: 77 RFVTGESGLQPEGRHP 92 >ref|YP_005415574.1| hypothetical protein RSPPHO_03265, partial [Rhodospirillum photometricum DSM 122] gi|504226143|ref|WP_014413245.1| hypothetical protein, partial [Rhodospirillum photometricum] gi|378401488|emb|CCG06604.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum DSM 122] Length = 104 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/55 (67%), Positives = 40/55 (72%) Frame = -3 Query: 217 VSKAGSGLSPEFSLPT*RTAYELFTPNNSGQRLHPTYYRGCWHVVSRCFFCRYRH 53 VSKA GLSP S T TAY LFTP++S QRL P+YYRGCWH VSR FF YRH Sbjct: 2 VSKAFPGLSPGLSPLTDLTAYALFTPSDSEQRLPPSYYRGCWHEVSRGFFWCYRH 56 >emb|CDN41090.1| hypothetical protein BN871_AB_00880 [Paenibacillus sp. P22] Length = 217 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/49 (67%), Positives = 36/49 (73%) Frame = -3 Query: 199 GLSPEFSLPT*RTAYELFTPNNSGQRLHPTYYRGCWHVVSRCFFCRYRH 53 GLSP+ T + A FTPNNSGQRL PTYYRGCWHVVS+ F RYRH Sbjct: 93 GLSPKIKHRTYKAACARFTPNNSGQRLPPTYYRGCWHVVSQGFLLRYRH 141 >ref|YP_001680916.1| hypothetical protein HM1_3147 [Heliobacterium modesticaldum Ice1] gi|501240384|ref|WP_012283402.1| hypothetical protein [Heliobacterium modesticaldum] gi|167593157|gb|ABZ84905.1| hypothetical protein HM1_3147 [Heliobacterium modesticaldum Ice1] Length = 69 Score = 69.3 bits (168), Expect = 5e-10 Identities = 38/55 (69%), Positives = 42/55 (76%) Frame = +2 Query: 5 DGGLRVVNLSAGKKR*VTVPAEEAPANYVPAAAVIRRVQALSGIIGRKELVGGPL 169 D GLR+VN +R +TVP EEAPANYVPAAAVIRR +ALSGI GRK GGPL Sbjct: 13 DEGLRIVNPCLQGRR-MTVPEEEAPANYVPAAAVIRRGRALSGITGRKARAGGPL 66 >ref|WP_016520404.1| hypothetical protein, partial [Treponema socranskii] gi|513480706|gb|EPF26580.1| hypothetical protein HMPREF1221_00764, partial [Treponema socranskii subsp. paredis ATCC 35535] Length = 235 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/59 (57%), Positives = 35/59 (59%) Frame = -3 Query: 229 SSPPVSKAGSGLSPEFSLPT*RTAYELFTPNNSGQRLHPTYYRGCWHVVSRCFFCRYRH 53 SS PV LSP S R A FTPNNS QR H T YRGCWHV+SRC F YRH Sbjct: 36 SSSPVLNIAPELSPGISYQAWRPACMPFTPNNSEQRSHLTCYRGCWHVISRCLFLPYRH 94 >gb|ETI87245.1| hypothetical protein Q615_SPAC00010G0001 [Streptococcus anginosus DORA_7] Length = 186 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/53 (62%), Positives = 34/53 (64%) Frame = -3 Query: 196 LSPEFSLPT*RTAYELFTPNNSGQRLHPTYYRGCWHVVSRCFFCRYRHLTLLP 38 LS SL T TA FTPN SGQR PTYYRGCWHVVSR F +YRH P Sbjct: 94 LSHCLSLQTFLTACARFTPNKSGQRSGPTYYRGCWHVVSRPFLVKYRHSMNFP 146 >ref|WP_006588044.1| permease [Lactobacillus jensenii] gi|238832245|gb|EEQ24559.1| hypothetical protein LACJE0001_1464 [Lactobacillus jensenii 269-3] Length = 174 Score = 65.9 bits (159), Expect = 6e-09 Identities = 37/75 (49%), Positives = 43/75 (57%), Gaps = 7/75 (9%) Frame = -3 Query: 217 VSKAGSGLSPEFSLPT*RTAYELFTPNNSGQRLHPTYYRGCWHVVSRCFFCRYRHLTL-- 44 VS A LS S T ++A FTPN SGQRL PTYYRGCWHVVSR F YR + Sbjct: 44 VSDAVLRLSRRLSHQTYQSACARFTPNKSGQRLPPTYYRGCWHVVSRDFLVDYRQIKASY 103 Query: 43 -----LPCRKVYNPK 14 P ++Y+PK Sbjct: 104 YLYPSSPTTELYDPK 118 >gb|ABP91180.1| unknown protein [Streptococcus suis 98HAH33] gi|145690754|gb|ABP91259.1| unknown protein [Streptococcus suis 98HAH33] gi|145690985|gb|ABP91490.1| unknown protein [Streptococcus suis 98HAH33] gi|145691080|gb|ABP91585.1| unknown protein [Streptococcus suis 98HAH33] Length = 186 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/53 (60%), Positives = 34/53 (64%) Frame = -3 Query: 196 LSPEFSLPT*RTAYELFTPNNSGQRLHPTYYRGCWHVVSRCFFCRYRHLTLLP 38 LS L T +TA FTPN SGQR PTYYRGCWHVVSR F RYR + P Sbjct: 94 LSHSLLLQTYQTACARFTPNKSGQRSGPTYYRGCWHVVSRPFLVRYRQVRNFP 146 >ref|YP_003602124.1| pg1 protein, homology to Homo sapiens [Lactobacillus crispatus ST1] gi|502851818|ref|WP_013086794.1| permease [Lactobacillus crispatus] gi|295031620|emb|CBL51099.1| PG1 protein, homology to Homo sapiens [Lactobacillus crispatus ST1] Length = 144 Score = 65.1 bits (157), Expect = 1e-08 Identities = 38/79 (48%), Positives = 43/79 (54%), Gaps = 7/79 (8%) Frame = -3 Query: 229 SSPPVSKAGSGLSPEFSLPT*RTAYELFTPNNSGQRLHPTYYRGCWHVVSRCFFCRYRHL 50 S VS A LS S T +A FTPN SGQRL PTYYRGCWHVVSR F YR + Sbjct: 10 SRKTVSDAVPRLSRGLSHQTYSSACARFTPNKSGQRLPPTYYRGCWHVVSRDFLVDYRQI 69 Query: 49 TL-------LPCRKVYNPK 14 P ++Y+PK Sbjct: 70 KASYYLYPSSPTTELYDPK 88 >ref|YP_003600533.1| pg1 protein, homology to Homo sapiens [Lactobacillus crispatus ST1] gi|295692302|ref|YP_003600912.1| pg1 protein, homology to Homo sapiens [Lactobacillus crispatus ST1] gi|295692314|ref|YP_003600924.1| pg1 protein, homology to Homo sapiens [Lactobacillus crispatus ST1] gi|502850658|ref|WP_013085634.1| permease [Lactobacillus crispatus] gi|295030029|emb|CBL49508.1| PG1 protein, homology to Homo sapiens [Lactobacillus crispatus ST1] gi|295030408|emb|CBL49887.1| PG1 protein, homology to Homo sapiens [Lactobacillus crispatus ST1] gi|295030420|emb|CBL49899.1| PG1 protein, homology to Homo sapiens [Lactobacillus crispatus ST1] Length = 144 Score = 65.1 bits (157), Expect = 1e-08 Identities = 38/79 (48%), Positives = 43/79 (54%), Gaps = 7/79 (8%) Frame = -3 Query: 229 SSPPVSKAGSGLSPEFSLPT*RTAYELFTPNNSGQRLHPTYYRGCWHVVSRCFFCRYRHL 50 S VS A LS S T +A FTPN SGQRL PTYYRGCWHVVSR F YR + Sbjct: 10 SRKTVSDAVPRLSRGLSHQTYSSACARFTPNKSGQRLPPTYYRGCWHVVSRDFLVDYRQI 69 Query: 49 TL-------LPCRKVYNPK 14 P ++Y+PK Sbjct: 70 KASYYLYPSSPTTELYDPK 88 >ref|WP_022187435.1| putative uncharacterized protein [Azospirillum sp. CAG:260] gi|524390510|emb|CDB39267.1| putative uncharacterized protein [Azospirillum sp. CAG:260] Length = 146 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/55 (58%), Positives = 37/55 (67%) Frame = -3 Query: 217 VSKAGSGLSPEFSLPT*RTAYELFTPNNSGQRLHPTYYRGCWHVVSRCFFCRYRH 53 + K SG+SP + TAY FTP+NS QRL P+YYRGCWH VSR FF YRH Sbjct: 48 IPKLSSGISPLSYI----TAYTPFTPSNSEQRLPPSYYRGCWHEVSRGFFRCYRH 98 >ref|WP_006586439.1| hypothetical protein, partial [Lactobacillus jensenii] gi|297150265|gb|EFH30562.1| hypothetical protein HMPREF0526_10715, partial [Lactobacillus jensenii JV-V16] Length = 120 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/60 (51%), Positives = 37/60 (61%), Gaps = 7/60 (11%) Frame = -3 Query: 172 T*RTAYELFTPNNSGQRLHPTYYRGCWHVVSRCFFCRYRHLTL-------LPCRKVYNPK 14 T ++A FTPN SGQRL PTYYRGCWHVVSR F YR + P ++Y+PK Sbjct: 5 TYQSACARFTPNKSGQRLPPTYYRGCWHVVSRDFLVDYRQIKASYYLYPSSPTTELYDPK 64 >emb|CBY13234.1| unnamed protein product [Oikopleura dioica] Length = 210 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/56 (57%), Positives = 35/56 (62%) Frame = -3 Query: 226 SPPVSKAGSGLSPEFSLPT*RTAYELFTPNNSGQRLHPTYYRGCWHVVSRCFFCRY 59 S VS A GLSP S T AY FTP++S QR P+YYRGCWH VSR F RY Sbjct: 29 SMAVSDAVPGLSPGISRLTYHAAYAPFTPSDSEQRSGPSYYRGCWHEVSRPFLFRY 84 >ref|WP_023269490.1| hypothetical protein [Propionibacterium acnes] gi|554753424|gb|ESK57857.1| hypothetical protein PAJL_2581 [Propionibacterium acnes HL042PA3] Length = 37 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 53 VTVPAEEAPANYVPAAAVIRRVQALSGIIGRKELVGG 163 +TV +EAPANYVPAAAVIRRV+ALSG IGRK LVGG Sbjct: 1 MTVMGKEAPANYVPAAAVIRRVRALSGFIGRKGLVGG 37 >ref|WP_018392648.1| hypothetical protein [Bacillus sp. 37MA] Length = 77 Score = 58.2 bits (139), Expect = 1e-06 Identities = 35/62 (56%), Positives = 40/62 (64%), Gaps = 7/62 (11%) Frame = +2 Query: 5 DGGLRVVNLSAGKK-------R*VTVPAEEAPANYVPAAAVIRRVQALSGIIGRKELVGG 163 D G R+V L + R +TVP ++A ANYVPAAAVIRR QALSGIIGRK GG Sbjct: 13 DEGFRIVKLCCQGRTRTGVTVRTLTVPDQKATANYVPAAAVIRRWQALSGIIGRKARAGG 72 Query: 164 PL 169 L Sbjct: 73 LL 74 >ref|WP_006547558.1| hypothetical protein [Actinomyces coleocanis] gi|226831233|gb|EEH63616.1| hypothetical protein HMPREF0044_1121 [Actinomyces coleocanis DSM 15436] Length = 45 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 53 VTVPAEEAPANYVPAAAVIRRVQALSGIIGRKELVGG 163 +T+ +E PANYVPAAAVIRRV ALSGIIGRK LVGG Sbjct: 4 LTLTGKEVPANYVPAAAVIRRVLALSGIIGRKGLVGG 40 >ref|WP_001330868.1| hypothetical protein, partial [Escherichia coli] gi|324020464|gb|EGB89683.1| hypothetical protein HMPREF9542_00832, partial [Escherichia coli MS 117-3] Length = 45 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +2 Query: 53 VTVPAEEAPANYVPAAAVIRRVQALSGIIGRKELVGGPL 169 +T+PAEEAPAN VPAAAVIRRVQAL GI GRK GG L Sbjct: 4 LTLPAEEAPANSVPAAAVIRRVQALIGITGRKAHAGGLL 42 >ref|WP_001335213.1| hypothetical protein [Enterobacteriaceae] gi|300308162|gb|EFJ62682.1| hypothetical protein HMPREF9553_01205 [Escherichia coli MS 200-1] gi|391249336|gb|EIQ08571.1| hypothetical protein SFK1770_3638 [Shigella flexneri K-1770] gi|391316109|gb|EIQ73589.1| hypothetical protein SF123566_4562 [Shigella flexneri 1235-66] gi|427271494|gb|EKW36294.1| hypothetical protein EC950943_0335 [Escherichia coli 95.0943] Length = 42 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +2 Query: 53 VTVPAEEAPANYVPAAAVIRRVQALSGIIGRKELVGGPL 169 +T+PAEEAPAN VPAAAVIRRVQAL GI GRK GG L Sbjct: 1 MTLPAEEAPANSVPAAAVIRRVQALIGITGRKAHAGGLL 39 >ref|WP_006785033.1| hypothetical protein [Turicibacter sanguinis] gi|292645357|gb|EFF63412.1| conserved hypothetical protein [Turicibacter sanguinis PC909] Length = 37 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 53 VTVPAEEAPANYVPAAAVIRRVQALSGIIGRKELVGG 163 +TVP E+A ANYVPAAAVIRR +ALSGIIGRKE GG Sbjct: 1 MTVPYEKATANYVPAAAVIRRWRALSGIIGRKERAGG 37 >gb|AHU34758.1| membrane protein, partial [Salmonella enterica subsp. enterica serovar Enteritidis str. EC20120918] Length = 37 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +2 Query: 53 VTVPAEEAPANYVPAAAVIRRVQALSGIIGRKELVGG 163 +T+PAEEAPAN VPAAAVIRRVQAL GI GRK GG Sbjct: 1 MTLPAEEAPANSVPAAAVIRRVQALIGITGRKAHAGG 37