BLASTX nr result
ID: Mentha27_contig00042486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00042486 (452 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDK13061.1| putative predicted protein [Malus domestica] 57 2e-06 ref|XP_003536140.1| PREDICTED: RNA-binding protein 42-like isofo... 57 3e-06 ref|XP_006487710.1| PREDICTED: RNA-binding protein 42-like [Citr... 55 8e-06 ref|XP_006442672.1| hypothetical protein CICLE_v10021882mg [Citr... 55 8e-06 ref|XP_007205778.1| hypothetical protein PRUPE_ppa010477mg [Prun... 55 8e-06 gb|EXB93170.1| RNA-binding protein 42 [Morus notabilis] 55 1e-05 >emb|CDK13061.1| putative predicted protein [Malus domestica] Length = 389 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 358 LYIKVVRDKRTGKTKGYGFISFANPSDLVGA 450 ++ KVVRDKRTGKTKG+GF+SFANPSDL GA Sbjct: 239 IHSKVVRDKRTGKTKGFGFVSFANPSDLAGA 269 >ref|XP_003536140.1| PREDICTED: RNA-binding protein 42-like isoform X1 [Glycine max] gi|571483337|ref|XP_006589208.1| PREDICTED: RNA-binding protein 42-like isoform X2 [Glycine max] Length = 248 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 367 KVVRDKRTGKTKGYGFISFANPSDLVGA 450 +VVRDKRTGKTKGYGF+SFANPSDL GA Sbjct: 170 RVVRDKRTGKTKGYGFVSFANPSDLAGA 197 >ref|XP_006487710.1| PREDICTED: RNA-binding protein 42-like [Citrus sinensis] Length = 274 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 367 KVVRDKRTGKTKGYGFISFANPSDLVGA 450 KVVRDKRTGKTKGYGFISFANPSD+ A Sbjct: 196 KVVRDKRTGKTKGYGFISFANPSDIAAA 223 >ref|XP_006442672.1| hypothetical protein CICLE_v10021882mg [Citrus clementina] gi|557544934|gb|ESR55912.1| hypothetical protein CICLE_v10021882mg [Citrus clementina] Length = 247 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 367 KVVRDKRTGKTKGYGFISFANPSDLVGA 450 KVVRDKRTGKTKGYGFISFANPSD+ A Sbjct: 169 KVVRDKRTGKTKGYGFISFANPSDIAAA 196 >ref|XP_007205778.1| hypothetical protein PRUPE_ppa010477mg [Prunus persica] gi|462401420|gb|EMJ06977.1| hypothetical protein PRUPE_ppa010477mg [Prunus persica] Length = 248 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +1 Query: 367 KVVRDKRTGKTKGYGFISFANPSDLVGA 450 +VVRDKRTGKTKG+GF+SFANPSDL GA Sbjct: 170 RVVRDKRTGKTKGFGFVSFANPSDLAGA 197 >gb|EXB93170.1| RNA-binding protein 42 [Morus notabilis] Length = 95 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 358 LYIKVVRDKRTGKTKGYGFISFANPSDLVGA 450 L + VVRDKRTGKTKGYGF+SFANPSDL A Sbjct: 14 LNVLVVRDKRTGKTKGYGFVSFANPSDLAAA 44