BLASTX nr result
ID: Mentha27_contig00042463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00042463 (270 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17773.1| hypothetical protein MIMGU_mgv1a002577mg [Mimulus... 59 5e-07 ref|XP_006351445.1| PREDICTED: probable Ufm1-specific protease-l... 58 1e-06 ref|XP_004236306.1| PREDICTED: probable Ufm1-specific protease-l... 56 6e-06 >gb|EYU17773.1| hypothetical protein MIMGU_mgv1a002577mg [Mimulus guttatus] Length = 657 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 167 KESGVQWLIGSPFFPSPTIVSTVRCLHTLPSNPL 268 KE+G QWLIGS F PS +IVST+RCLHTLPS+PL Sbjct: 21 KEAGFQWLIGSQFLPSLSIVSTIRCLHTLPSDPL 54 >ref|XP_006351445.1| PREDICTED: probable Ufm1-specific protease-like [Solanum tuberosum] Length = 643 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +2 Query: 170 ESGVQWLIGSPFFPSPTIVSTVRCLHTLPSNPL 268 ESG+QWLIGSPFFP T++ST RC+HT SNPL Sbjct: 23 ESGLQWLIGSPFFPRYTVISTFRCIHTTSSNPL 55 >ref|XP_004236306.1| PREDICTED: probable Ufm1-specific protease-like [Solanum lycopersicum] Length = 646 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +2 Query: 170 ESGVQWLIGSPFFPSPTIVSTVRCLHTLPSNPL 268 ESG+QWLIGSPFFP T++ST RC+HT SN L Sbjct: 23 ESGIQWLIGSPFFPRYTVISTFRCIHTTSSNSL 55