BLASTX nr result
ID: Mentha27_contig00042208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00042208 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004293013.1| PREDICTED: carbon catabolite repressor prote... 57 3e-06 >ref|XP_004293013.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6-like [Fragaria vesca subsp. vesca] Length = 804 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = +2 Query: 5 RPYFRSGRSQHGRGYCDRPVGPAAGDRPEFVSGDSHFGAVRDANRGF-QPSYNAVPPPPQ 181 RP+FR GR+Q RGY +RP+ + G R +V+GDSH +V++AN GF Q PPPQ Sbjct: 24 RPHFRGGRNQSNRGYSNRPI--SGGGRGHYVTGDSHIRSVQEANLGFRQGDTGHHRPPPQ 81