BLASTX nr result
ID: Mentha27_contig00042049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00042049 (487 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_817244.1| ORF45d [Pinus koraiensis] gi|29469761|gb|AAO740... 59 5e-07 >ref|NP_817244.1| ORF45d [Pinus koraiensis] gi|29469761|gb|AAO74089.1| ORF45d [Pinus koraiensis] Length = 45 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 364 CQEPDLNW*HEDFQSSALPAELSRPFPM*HP 272 CQEPDLNW HEDFQSSALP ELSR FP+ HP Sbjct: 11 CQEPDLNWWHEDFQSSALPTELSRLFPVDHP 41