BLASTX nr result
ID: Mentha27_contig00041480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00041480 (232 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS69382.1| hypothetical protein M569_05385 [Genlisea aurea] 74 2e-11 gb|AAU93580.1| Putative F-box protein, identical [Solanum demissum] 61 2e-07 gb|AAT39292.1| Putative F-box domain containing protein, identic... 59 5e-07 gb|AAT38720.1| Putative F-Box protein, identical [Solanum demissum] 59 5e-07 ref|XP_004229229.1| PREDICTED: F-box protein CPR30-like [Solanum... 55 8e-06 >gb|EPS69382.1| hypothetical protein M569_05385 [Genlisea aurea] Length = 349 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/70 (51%), Positives = 46/70 (65%) Frame = +3 Query: 3 DEWKSIKSFEGHSLMSDPATFANGKLYWIANYDYELDLGLYIVSLDLEEEEFDILQMPSY 182 +EW+ ++ ++GHSLM+DPA F NGKL+W D G IVS+DLE EE+ MP Y Sbjct: 175 NEWRRMRDYKGHSLMADPAVFVNGKLHWNTIVD-PTSGGWDIVSVDLETEEYGTFGMPDY 233 Query: 183 VKGGYYSRLG 212 VK G YS LG Sbjct: 234 VKSGSYSALG 243 >gb|AAU93580.1| Putative F-box protein, identical [Solanum demissum] Length = 261 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/77 (41%), Positives = 45/77 (58%), Gaps = 1/77 (1%) Frame = +3 Query: 3 DEWKSIKSFEGHSLMSDPATFANGKLYWIANYDYELDLGLYIVSLDLEEEEFDILQMP-S 179 D W++I F+G+ L++ P F NGKLYW + D + I+SLDL +E + L++P S Sbjct: 80 DSWRTINKFQGNFLVNSPGKFVNGKLYWALSADVDTFNMCNIISLDLADETWRRLELPDS 139 Query: 180 YVKGGYYSRLGESEGCL 230 Y KG Y LG E L Sbjct: 140 YGKGSYPLALGVVESHL 156 >gb|AAT39292.1| Putative F-box domain containing protein, identical [Solanum demissum] Length = 307 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%) Frame = +3 Query: 3 DEWKSIKSFEGHSLMSDPATFANGKLYWIANYDYELDLGLYIVSLDLEEEEFDILQMP-S 179 D W++I F+G+ L++ P F NGK+YW + D + I+SLDL +E + L++P S Sbjct: 126 DSWRTINKFQGNFLVNSPGKFVNGKIYWALSADVDTFNMCNIISLDLADETWRRLELPDS 185 Query: 180 YVKGGYYSRLG 212 Y KG Y LG Sbjct: 186 YGKGSYPLALG 196 >gb|AAT38720.1| Putative F-Box protein, identical [Solanum demissum] Length = 372 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%) Frame = +3 Query: 3 DEWKSIKSFEGHSLMSDPATFANGKLYWIANYDYELDLGLYIVSLDLEEEEFDILQMP-S 179 D W++I F+G+ L++ P F NGK+YW + D + I+SLDL +E + L++P S Sbjct: 191 DSWRTINKFQGNFLVNSPGKFVNGKIYWALSADVDTFNMCNIISLDLADETWRRLELPDS 250 Query: 180 YVKGGYYSRLG 212 Y KG Y LG Sbjct: 251 YGKGSYPLALG 261 >ref|XP_004229229.1| PREDICTED: F-box protein CPR30-like [Solanum lycopersicum] Length = 371 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Frame = +3 Query: 9 WKSIKSFEGHSLMSDPATFANGKLYWIANYDY-ELDLGLYIVSLDLEEEEFDILQMPSYV 185 W SI+ F+ + + A FANG L+W YDY + IV+LDL +E + + +P Y Sbjct: 197 WSSIQGFDSGHVNGNVAVFANGVLHWEGCYDYVSGGVSSEIVTLDLAKERYGRIALPRYE 256 Query: 186 KGGYYSRLGESEGCL 230 GG + LGES G L Sbjct: 257 GGGIHWTLGESRGRL 271