BLASTX nr result
ID: Mentha27_contig00041343
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00041343 (446 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74704.1| hypothetical protein M569_00079, partial [Genlise... 67 2e-09 >gb|EPS74704.1| hypothetical protein M569_00079, partial [Genlisea aurea] Length = 88 Score = 67.4 bits (163), Expect = 2e-09 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 1/60 (1%) Frame = +3 Query: 270 VWYLTGH*NRTEPLVRLLFS*SYYGVRHRFLNKIHF-LDCMVDSPEKHWRACKRVALPTE 446 V++ GH NRT+P V LLFS SY GVRHR ++I + M++SPEK WRACKR ALPTE Sbjct: 29 VYFCFGHSNRTKPFVMLLFSQSY-GVRHRLQDQISIDFEWMMESPEKPWRACKRGALPTE 87