BLASTX nr result
ID: Mentha27_contig00041281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00041281 (306 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41126.1| hypothetical protein MIMGU_mgv1a008379mg [Mimulus... 62 1e-07 >gb|EYU41126.1| hypothetical protein MIMGU_mgv1a008379mg [Mimulus guttatus] Length = 375 Score = 61.6 bits (148), Expect = 1e-07 Identities = 36/50 (72%), Positives = 38/50 (76%), Gaps = 4/50 (8%) Frame = +3 Query: 54 RKFSPEIQRRD---KDPAASELLRLPWSVPVGPRSKRCA-GSVTERNFSV 191 RK SP RRD KDPA S+ LR+PWSVPVGPRSKR GSVTERNFSV Sbjct: 189 RKNSPA--RRDHPEKDPAPSQTLRIPWSVPVGPRSKRTGPGSVTERNFSV 236