BLASTX nr result
ID: Mentha27_contig00041142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00041142 (208 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515026.1| steroid dehydrogenase, putative [Ricinus com... 85 9e-15 gb|EYU25963.1| hypothetical protein MIMGU_mgv1a023265mg [Mimulus... 83 3e-14 gb|EYU25962.1| hypothetical protein MIMGU_mgv1a017398mg [Mimulus... 83 3e-14 ref|XP_004164189.1| PREDICTED: very-long-chain 3-oxoacyl-CoA red... 82 1e-13 ref|XP_004135293.1| PREDICTED: very-long-chain 3-oxoacyl-CoA red... 82 1e-13 ref|XP_002515028.1| steroid dehydrogenase, putative [Ricinus com... 82 1e-13 gb|EPS66419.1| hypothetical protein M569_08359, partial [Genlise... 81 1e-13 gb|EXB82449.1| Inactive hydroxysteroid dehydrogenase-like protei... 79 7e-13 ref|XP_006484333.1| PREDICTED: very-long-chain 3-oxoacyl-CoA red... 78 1e-12 ref|XP_006438163.1| hypothetical protein CICLE_v10033895mg [Citr... 78 1e-12 ref|XP_007044935.1| 3-ketoacyl-CoA reductase 1 [Theobroma cacao]... 78 1e-12 ref|XP_004310011.1| PREDICTED: very-long-chain 3-oxoacyl-CoA red... 77 2e-12 ref|XP_004504160.1| PREDICTED: very-long-chain 3-oxoacyl-CoA red... 76 4e-12 gb|AAX92988.1| Similar to b-keto acyl reductase [Oryza sativa Ja... 76 4e-12 gb|EEE52045.1| hypothetical protein OsJ_33774 [Oryza sativa Japo... 76 4e-12 gb|EAY80782.1| hypothetical protein OsI_35962 [Oryza sativa Indi... 76 4e-12 ref|NP_001067794.1| Os11g0432600 [Oryza sativa Japonica Group] g... 76 4e-12 ref|XP_007224023.1| hypothetical protein PRUPE_ppa015113mg [Prun... 75 7e-12 ref|XP_003532805.1| PREDICTED: very-long-chain 3-oxoacyl-CoA red... 75 9e-12 dbj|BAJ90205.1| predicted protein [Hordeum vulgare subsp. vulgare] 72 6e-11 >ref|XP_002515026.1| steroid dehydrogenase, putative [Ricinus communis] gi|223546077|gb|EEF47580.1| steroid dehydrogenase, putative [Ricinus communis] Length = 331 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/50 (76%), Positives = 40/50 (80%) Frame = -1 Query: 205 YVEAAIRFIGYERRCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIARMNN 56 Y EAAIR IGYE RCTPYWAHSLQWFF +LP +LDSWRLSIGI R N Sbjct: 266 YAEAAIRCIGYEARCTPYWAHSLQWFFVRLLPEAVLDSWRLSIGIHRRGN 315 >gb|EYU25963.1| hypothetical protein MIMGU_mgv1a023265mg [Mimulus guttatus] Length = 111 Score = 83.2 bits (204), Expect = 3e-14 Identities = 35/53 (66%), Positives = 47/53 (88%), Gaps = 1/53 (1%) Frame = -1 Query: 208 KYVEAAIRFIGYER-RCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIARMNNS 53 KYVE+AIRFIG+++ RCTPYW HS+QWFF+S+LP LL++WRLSIG+ R+ N+ Sbjct: 53 KYVESAIRFIGHDQARCTPYWTHSIQWFFASLLPDSLLNAWRLSIGLKRIKNT 105 >gb|EYU25962.1| hypothetical protein MIMGU_mgv1a017398mg [Mimulus guttatus] Length = 77 Score = 83.2 bits (204), Expect = 3e-14 Identities = 35/53 (66%), Positives = 47/53 (88%), Gaps = 1/53 (1%) Frame = -1 Query: 208 KYVEAAIRFIGYER-RCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIARMNNS 53 KYVE+AIRFIG+++ RCTPYW HS+QWFF+S+LP LL++WRLSIG+ R+ N+ Sbjct: 20 KYVESAIRFIGHDQARCTPYWTHSIQWFFASLLPDSLLNAWRLSIGLKRIKNT 72 >ref|XP_004164189.1| PREDICTED: very-long-chain 3-oxoacyl-CoA reductase-like protein At1g24470-like [Cucumis sativus] Length = 332 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/53 (66%), Positives = 42/53 (79%) Frame = -1 Query: 205 YVEAAIRFIGYERRCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIARMNNSRI 47 YV+AAIR IGYE RCTPYWAHSLQW F+S+LP +LD+WRLSIG+ R + Sbjct: 269 YVKAAIRQIGYEPRCTPYWAHSLQWCFASLLPEAMLDAWRLSIGLERRRKESV 321 >ref|XP_004135293.1| PREDICTED: very-long-chain 3-oxoacyl-CoA reductase-like protein At1g24470-like [Cucumis sativus] Length = 332 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/53 (66%), Positives = 42/53 (79%) Frame = -1 Query: 205 YVEAAIRFIGYERRCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIARMNNSRI 47 YV+AAIR IGYE RCTPYWAHSLQW F+S+LP +LD+WRLSIG+ R + Sbjct: 269 YVKAAIRQIGYEPRCTPYWAHSLQWCFASLLPEAMLDAWRLSIGLERRRKESV 321 >ref|XP_002515028.1| steroid dehydrogenase, putative [Ricinus communis] gi|223546079|gb|EEF47582.1| steroid dehydrogenase, putative [Ricinus communis] Length = 342 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/47 (76%), Positives = 39/47 (82%) Frame = -1 Query: 205 YVEAAIRFIGYERRCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIAR 65 Y EAA+R IGYE RCTPYWAHSLQWFFS +L +LDSWRLSIGI R Sbjct: 275 YAEAAVRRIGYEARCTPYWAHSLQWFFSRLLSEAVLDSWRLSIGIHR 321 >gb|EPS66419.1| hypothetical protein M569_08359, partial [Genlisea aurea] Length = 304 Score = 81.3 bits (199), Expect = 1e-13 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = -1 Query: 205 YVEAAIRFIGYERRCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIAR 65 YVEAA+RFIG+E RC+PYWAHS+QWFF+S+LP +LD+WR SIG+ R Sbjct: 254 YVEAAVRFIGHEPRCSPYWAHSVQWFFASLLPEYVLDTWRYSIGLRR 300 >gb|EXB82449.1| Inactive hydroxysteroid dehydrogenase-like protein 1 [Morus notabilis] Length = 321 Score = 79.0 bits (193), Expect = 7e-13 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -1 Query: 205 YVEAAIRFIGYERRCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIAR 65 Y +AAIR IGYE RCTPYWAHSLQWFF+S L +LD+WRL+IGI R Sbjct: 271 YAKAAIRRIGYEARCTPYWAHSLQWFFASFLSEDILDAWRLAIGIRR 317 >ref|XP_006484333.1| PREDICTED: very-long-chain 3-oxoacyl-CoA reductase-like protein At1g24470-like [Citrus sinensis] Length = 331 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/47 (72%), Positives = 38/47 (80%) Frame = -1 Query: 205 YVEAAIRFIGYERRCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIAR 65 Y AAIR IGYE RCTPYWAHS+QW F+ +LP LLD+WRLSIGI R Sbjct: 277 YARAAIRCIGYEPRCTPYWAHSVQWCFARLLPDSLLDAWRLSIGIRR 323 >ref|XP_006438163.1| hypothetical protein CICLE_v10033895mg [Citrus clementina] gi|557540359|gb|ESR51403.1| hypothetical protein CICLE_v10033895mg [Citrus clementina] Length = 290 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/47 (72%), Positives = 38/47 (80%) Frame = -1 Query: 205 YVEAAIRFIGYERRCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIAR 65 Y AAIR IGYE RCTPYWAHS+QW F+ +LP LLD+WRLSIGI R Sbjct: 236 YARAAIRCIGYEPRCTPYWAHSVQWCFARLLPDSLLDAWRLSIGIRR 282 >ref|XP_007044935.1| 3-ketoacyl-CoA reductase 1 [Theobroma cacao] gi|508708870|gb|EOY00767.1| 3-ketoacyl-CoA reductase 1 [Theobroma cacao] Length = 352 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -1 Query: 205 YVEAAIRFIGYERRCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIAR 65 Y EA IR IGYE RCTPYW+HS+QW F+ +LP LLD+WRLS+GI R Sbjct: 300 YAEAGIRHIGYEPRCTPYWSHSIQWCFARLLPDALLDAWRLSVGIRR 346 >ref|XP_004310011.1| PREDICTED: very-long-chain 3-oxoacyl-CoA reductase-like protein At1g24470-like [Fragaria vesca subsp. vesca] Length = 325 Score = 77.0 bits (188), Expect = 2e-12 Identities = 31/47 (65%), Positives = 40/47 (85%) Frame = -1 Query: 205 YVEAAIRFIGYERRCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIAR 65 Y EAA++ IGYE RCTP+WAHSLQW+F+ ++P LLD+WRLSIG+ R Sbjct: 272 YAEAAVKRIGYEARCTPFWAHSLQWWFARLVPDSLLDAWRLSIGLNR 318 >ref|XP_004504160.1| PREDICTED: very-long-chain 3-oxoacyl-CoA reductase-like protein At1g24470-like [Cicer arietinum] Length = 322 Score = 76.3 bits (186), Expect = 4e-12 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = -1 Query: 205 YVEAAIRFIGYERRCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIARMNN 56 Y AAIR IGY +CTPYWAHS+QW F+ ++P PLLD WRLSIG+ R N+ Sbjct: 271 YARAAIRQIGYGPKCTPYWAHSVQWAFARLIPDPLLDYWRLSIGMRRRNH 320 >gb|AAX92988.1| Similar to b-keto acyl reductase [Oryza sativa Japonica Group] Length = 167 Score = 76.3 bits (186), Expect = 4e-12 Identities = 29/54 (53%), Positives = 41/54 (75%) Frame = -1 Query: 208 KYVEAAIRFIGYERRCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIARMNNSRI 47 +Y +AA+R IGYE RC PYW HS+QWFF+S+LP +L+ WRL +GI + N ++ Sbjct: 104 EYAKAAVRCIGYEPRCVPYWRHSIQWFFASLLPDSVLNLWRLQVGIRKRNQMKV 157 >gb|EEE52045.1| hypothetical protein OsJ_33774 [Oryza sativa Japonica Group] Length = 319 Score = 76.3 bits (186), Expect = 4e-12 Identities = 29/54 (53%), Positives = 41/54 (75%) Frame = -1 Query: 208 KYVEAAIRFIGYERRCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIARMNNSRI 47 +Y +AA+R IGYE RC PYW HS+QWFF+S+LP +L+ WRL +GI + N ++ Sbjct: 256 EYAKAAVRCIGYEPRCVPYWRHSIQWFFASLLPDSVLNLWRLQVGIRKRNQMKV 309 >gb|EAY80782.1| hypothetical protein OsI_35962 [Oryza sativa Indica Group] Length = 167 Score = 76.3 bits (186), Expect = 4e-12 Identities = 29/54 (53%), Positives = 41/54 (75%) Frame = -1 Query: 208 KYVEAAIRFIGYERRCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIARMNNSRI 47 +Y +AA+R IGYE RC PYW HS+QWFF+S+LP +L+ WRL +GI + N ++ Sbjct: 104 EYAKAAVRCIGYEPRCVPYWRHSIQWFFASLLPDSVLNLWRLQVGIRKRNQMKV 157 >ref|NP_001067794.1| Os11g0432600 [Oryza sativa Japonica Group] gi|108864331|gb|ABA93118.2| oxidoreductase, short chain dehydrogenase/reductase family protein, expressed [Oryza sativa Japonica Group] gi|113645016|dbj|BAF28157.1| Os11g0432600 [Oryza sativa Japonica Group] Length = 339 Score = 76.3 bits (186), Expect = 4e-12 Identities = 29/54 (53%), Positives = 41/54 (75%) Frame = -1 Query: 208 KYVEAAIRFIGYERRCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIARMNNSRI 47 +Y +AA+R IGYE RC PYW HS+QWFF+S+LP +L+ WRL +GI + N ++ Sbjct: 276 EYAKAAVRCIGYEPRCVPYWRHSIQWFFASLLPDSVLNLWRLQVGIRKRNQMKV 329 >ref|XP_007224023.1| hypothetical protein PRUPE_ppa015113mg [Prunus persica] gi|462420959|gb|EMJ25222.1| hypothetical protein PRUPE_ppa015113mg [Prunus persica] Length = 321 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -1 Query: 205 YVEAAIRFIGYERRCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIAR 65 Y +AAIR IGYE RCTP+WAHSLQW S++P LLD+WRLSIG+ R Sbjct: 268 YAKAAIRRIGYEARCTPFWAHSLQWCLGSLVPESLLDAWRLSIGLKR 314 >ref|XP_003532805.1| PREDICTED: very-long-chain 3-oxoacyl-CoA reductase-like protein At1g24470-like [Glycine max] Length = 325 Score = 75.1 bits (183), Expect = 9e-12 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = -1 Query: 205 YVEAAIRFIGYERRCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIARMNNS 53 Y AAI IGY +CTPYWAHS+QW F++++P PLLD+WR SIG+ R N + Sbjct: 269 YARAAIGEIGYRPKCTPYWAHSIQWCFANLIPDPLLDAWRFSIGMRRRNQN 319 >dbj|BAJ90205.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 332 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = -1 Query: 208 KYVEAAIRFIGYERRCTPYWAHSLQWFFSSILPPPLLDSWRLSIGIARMNNSR 50 +YV+AAIR IGYE RC PYW HS+QWF +S+ P L+ WRL +GI + N R Sbjct: 271 EYVKAAIRCIGYEPRCVPYWRHSVQWFLASLAPDSALNLWRLRVGIRKRNEMR 323