BLASTX nr result
ID: Mentha27_contig00040846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00040846 (394 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31145.1| hypothetical protein MIMGU_mgv1a020597mg, partial... 59 9e-07 >gb|EYU31145.1| hypothetical protein MIMGU_mgv1a020597mg, partial [Mimulus guttatus] Length = 1336 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +3 Query: 270 MENIETLLAAVAQTQGFDDDERVASTASKLGSENS 374 MENIETLLAAVAQTQGFDDDE VASTA +LG NS Sbjct: 1 MENIETLLAAVAQTQGFDDDEPVASTAPELGLPNS 35