BLASTX nr result
ID: Mentha27_contig00040725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00040725 (825 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlise... 73 1e-10 >gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlisea aurea] Length = 72 Score = 72.8 bits (177), Expect = 1e-10 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +3 Query: 3 AWKARGYSRRRFSALNVSNSKPNVKLWFHSAPLWK 107 AWKA+GYSRRRFS+L+VSNSKPN+KLWFHSAPLW+ Sbjct: 23 AWKAKGYSRRRFSSLSVSNSKPNMKLWFHSAPLWR 57