BLASTX nr result
ID: Mentha27_contig00040657
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00040657 (229 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21838.1| hypothetical protein MIMGU_mgv1a001107mg [Mimulus... 49 6e-06 >gb|EYU21838.1| hypothetical protein MIMGU_mgv1a001107mg [Mimulus guttatus] Length = 888 Score = 48.9 bits (115), Expect(2) = 6e-06 Identities = 19/34 (55%), Positives = 27/34 (79%) Frame = +1 Query: 118 IWDIEACDEIQLFFPDCSNRSRVVVTTRLSNLAS 219 +W +E D++ LFFPD RSR+++TTRLSN+AS Sbjct: 262 VWSVEVWDKVNLFFPDNGERSRIMITTRLSNVAS 295 Score = 26.6 bits (57), Expect(2) = 6e-06 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +3 Query: 3 ISQQYNVREISEHLLRQVDEV-GEDDLLKMTENDLKEKLHLGY*GVR 140 +SQ YNVREI +L +++ + L +E +L K+H G R Sbjct: 208 VSQNYNVREILVEILLCINKAESRETLSAKSEGELGVKVHQSLWGRR 254