BLASTX nr result
ID: Mentha27_contig00040529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00040529 (247 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17425.1| hypothetical protein MIMGU_mgv1a012301mg [Mimulus... 57 3e-06 >gb|EYU17425.1| hypothetical protein MIMGU_mgv1a012301mg [Mimulus guttatus] Length = 254 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/56 (51%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -3 Query: 167 TTTDHYSNSMAAIIRPPQLM-MERGGGAAKWKFSNGSNEIAPNCPRCASSNTKFCY 3 TT+DH+ S + + PP L M + KW F+ E APNCPRCASSNTKFCY Sbjct: 6 TTSDHHQYSNSIVECPPPLRPMIMDTNSRKWNFTT-KIETAPNCPRCASSNTKFCY 60