BLASTX nr result
ID: Mentha27_contig00039864
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00039864 (240 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHL67261.1| copalyl diphosphate synthase [Rosmarinus officina... 84 3e-14 >gb|AHL67261.1| copalyl diphosphate synthase [Rosmarinus officinalis] Length = 799 Score = 83.6 bits (205), Expect = 3e-14 Identities = 43/77 (55%), Positives = 55/77 (71%), Gaps = 1/77 (1%) Frame = -2 Query: 230 MTATFSLQLSNAPTAYGRLQLPAKAHLPQFHTVCAWGNSGSKHEPLSCRFSCRKISEATK 51 MT+ SL LS AP RLQLPAK LP+F+ VC+W N+ SKH PLSC +++S+ TK Sbjct: 1 MTSMSSLNLSRAPAISRRLQLPAKVQLPEFYAVCSWLNNSSKHTPLSCHIHRKQLSKVTK 60 Query: 50 YR-ASLDSSQVTEKVSS 3 R ASLD+SQV+EK +S Sbjct: 61 CRVASLDASQVSEKGTS 77