BLASTX nr result
ID: Mentha27_contig00039606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00039606 (295 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22967.1| hypothetical protein MIMGU_mgv1a004299mg [Mimulus... 50 6e-09 ref|XP_002513757.1| chlorophyll synthase, putative [Ricinus comm... 46 2e-07 ref|XP_006472786.1| PREDICTED: chlorophyllide a oxygenase, chlor... 45 4e-07 ref|XP_006434201.1| hypothetical protein CICLE_v10000821mg [Citr... 45 5e-07 ref|XP_002302233.2| hypothetical protein POPTR_0002s08380g [Popu... 48 1e-06 ref|XP_006386373.1| hypothetical protein POPTR_0002s08380g [Popu... 48 1e-06 gb|AEI83421.1| chlorophyllide a oxygenase [Camellia sinensis] 45 2e-06 ref|XP_006351904.1| PREDICTED: chlorophyllide a oxygenase, chlor... 44 4e-06 ref|XP_004250311.1| PREDICTED: chlorophyllide a oxygenase, chlor... 44 4e-06 ref|XP_006393724.1| hypothetical protein EUTSA_v10011377mg [Eutr... 41 5e-06 ref|XP_002306638.2| hypothetical protein POPTR_0005s20060g [Popu... 45 6e-06 dbj|BAA82484.1| chlorophyll b synthase [Arabidopsis thaliana] 40 6e-06 ref|XP_006307209.1| hypothetical protein CARUB_v10008806mg [Caps... 40 6e-06 gb|AAD54323.1| chlorophyll a oxygenase [Arabidopsis thaliana] 40 6e-06 ref|NP_175088.1| chlorophyllide a oxygenase [Arabidopsis thalian... 40 6e-06 ref|NP_973969.1| chlorophyllide a oxygenase [Arabidopsis thalian... 40 6e-06 ref|NP_973970.1| chlorophyllide a oxygenase [Arabidopsis thalian... 40 6e-06 >gb|EYU22967.1| hypothetical protein MIMGU_mgv1a004299mg [Mimulus guttatus] Length = 534 Score = 49.7 bits (117), Expect(2) = 6e-09 Identities = 17/26 (65%), Positives = 26/26 (100%) Frame = +3 Query: 105 RCLKGGFGVFAIIGDEGGLIDRKSSW 182 RC++GGFGVFA++G+EGGL++RK++W Sbjct: 26 RCVRGGFGVFAVLGEEGGLVERKNTW 51 Score = 36.2 bits (82), Expect(2) = 6e-09 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = +2 Query: 197 VEDPCPNVSWYKDKFLDVNQALQVA 271 VEDP V YK+KFLD NQAL+VA Sbjct: 56 VEDPRSKVPQYKNKFLDANQALEVA 80 >ref|XP_002513757.1| chlorophyll synthase, putative [Ricinus communis] gi|223546843|gb|EEF48340.1| chlorophyll synthase, putative [Ricinus communis] Length = 535 Score = 45.8 bits (107), Expect(2) = 2e-07 Identities = 16/28 (57%), Positives = 25/28 (89%) Frame = +3 Query: 111 LKGGFGVFAIIGDEGGLIDRKSSWAAIF 194 ++GGFGVFA+ G+EGG++D+KS W+ +F Sbjct: 28 VRGGFGVFAVFGEEGGVLDKKSVWSTLF 55 Score = 34.7 bits (78), Expect(2) = 2e-07 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +2 Query: 197 VEDPCPNVSWYKDKFLDVNQALQVAIFGV 283 VEDP + K KFLDVNQAL+VA F + Sbjct: 57 VEDPRSKMPQLKGKFLDVNQALEVARFDI 85 >ref|XP_006472786.1| PREDICTED: chlorophyllide a oxygenase, chloroplastic-like [Citrus sinensis] Length = 535 Score = 45.4 bits (106), Expect(2) = 4e-07 Identities = 16/30 (53%), Positives = 26/30 (86%) Frame = +3 Query: 105 RCLKGGFGVFAIIGDEGGLIDRKSSWAAIF 194 + ++GGF VFA+ G+EGGL+D+KS+W+ +F Sbjct: 26 KSVRGGFRVFALFGEEGGLVDKKSAWSTLF 55 Score = 34.3 bits (77), Expect(2) = 4e-07 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +2 Query: 197 VEDPCPNVSWYKDKFLDVNQALQVAIFGV 283 VEDP V K KFLDVNQAL+VA + + Sbjct: 57 VEDPRSKVPQCKGKFLDVNQALEVARYDI 85 >ref|XP_006434201.1| hypothetical protein CICLE_v10000821mg [Citrus clementina] gi|557536323|gb|ESR47441.1| hypothetical protein CICLE_v10000821mg [Citrus clementina] Length = 535 Score = 45.1 bits (105), Expect(2) = 5e-07 Identities = 16/30 (53%), Positives = 26/30 (86%) Frame = +3 Query: 105 RCLKGGFGVFAIIGDEGGLIDRKSSWAAIF 194 + ++GGF VFA+ G+EGGL+D+KS+W+ +F Sbjct: 26 KSVRGGFRVFALFGEEGGLVDKKSAWSMLF 55 Score = 34.3 bits (77), Expect(2) = 5e-07 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +2 Query: 197 VEDPCPNVSWYKDKFLDVNQALQVAIFGV 283 VEDP V K KFLDVNQAL+VA + + Sbjct: 57 VEDPRSKVPQCKGKFLDVNQALEVARYDI 85 >ref|XP_002302233.2| hypothetical protein POPTR_0002s08380g [Populus trichocarpa] gi|550344554|gb|EEE81506.2| hypothetical protein POPTR_0002s08380g [Populus trichocarpa] Length = 535 Score = 48.1 bits (113), Expect(2) = 1e-06 Identities = 17/28 (60%), Positives = 26/28 (92%) Frame = +3 Query: 111 LKGGFGVFAIIGDEGGLIDRKSSWAAIF 194 ++GGFGVFA++G+EGGL+D+KS+W +F Sbjct: 28 VRGGFGVFAVLGEEGGLLDKKSTWGPLF 55 Score = 30.0 bits (66), Expect(2) = 1e-06 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +2 Query: 197 VEDPCPNVSWYKDKFLDVNQALQVAIFGV 283 VEDP + +K KFLD QAL+VA + + Sbjct: 57 VEDPRSKMPQFKGKFLDFYQALEVARYDI 85 >ref|XP_006386373.1| hypothetical protein POPTR_0002s08380g [Populus trichocarpa] gi|550344555|gb|ERP64170.1| hypothetical protein POPTR_0002s08380g [Populus trichocarpa] Length = 344 Score = 48.1 bits (113), Expect(2) = 1e-06 Identities = 17/28 (60%), Positives = 26/28 (92%) Frame = +3 Query: 111 LKGGFGVFAIIGDEGGLIDRKSSWAAIF 194 ++GGFGVFA++G+EGGL+D+KS+W +F Sbjct: 28 VRGGFGVFAVLGEEGGLLDKKSTWGPLF 55 Score = 30.0 bits (66), Expect(2) = 1e-06 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +2 Query: 197 VEDPCPNVSWYKDKFLDVNQALQVAIFGV 283 VEDP + +K KFLD QAL+VA + + Sbjct: 57 VEDPRSKMPQFKGKFLDFYQALEVARYDI 85 >gb|AEI83421.1| chlorophyllide a oxygenase [Camellia sinensis] Length = 536 Score = 44.7 bits (104), Expect(2) = 2e-06 Identities = 17/30 (56%), Positives = 25/30 (83%) Frame = +3 Query: 105 RCLKGGFGVFAIIGDEGGLIDRKSSWAAIF 194 R ++ GFGVFA+ G+EGGL D+KS+W+ +F Sbjct: 26 RGVRAGFGVFAVFGEEGGLEDKKSAWSTLF 55 Score = 32.7 bits (73), Expect(2) = 2e-06 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +2 Query: 197 VEDPCPNVSWYKDKFLDVNQALQVAIFGV 283 VEDP V K KFLDVNQAL++ F + Sbjct: 57 VEDPRSKVPQCKGKFLDVNQALELVRFDI 85 >ref|XP_006351904.1| PREDICTED: chlorophyllide a oxygenase, chloroplastic-like [Solanum tuberosum] Length = 535 Score = 44.3 bits (103), Expect(2) = 4e-06 Identities = 17/28 (60%), Positives = 23/28 (82%) Frame = +3 Query: 111 LKGGFGVFAIIGDEGGLIDRKSSWAAIF 194 +KG FGVFA+ G+EGG+ D+KSSW +F Sbjct: 30 VKGSFGVFAVYGEEGGIPDKKSSWLTLF 57 Score = 32.0 bits (71), Expect(2) = 4e-06 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = +2 Query: 197 VEDPCPNVSWYKDKFLDVNQALQVA 271 VEDP V K KFLD NQAL+VA Sbjct: 59 VEDPRTKVPQSKGKFLDANQALEVA 83 >ref|XP_004250311.1| PREDICTED: chlorophyllide a oxygenase, chloroplastic-like [Solanum lycopersicum] Length = 535 Score = 44.3 bits (103), Expect(2) = 4e-06 Identities = 17/28 (60%), Positives = 23/28 (82%) Frame = +3 Query: 111 LKGGFGVFAIIGDEGGLIDRKSSWAAIF 194 +KG FGVFA+ G+EGG+ D+KSSW +F Sbjct: 30 VKGSFGVFAVYGEEGGIPDKKSSWLTLF 57 Score = 32.0 bits (71), Expect(2) = 4e-06 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = +2 Query: 197 VEDPCPNVSWYKDKFLDVNQALQVA 271 VEDP V K KFLD NQAL+VA Sbjct: 59 VEDPRTKVPQSKGKFLDANQALEVA 83 >ref|XP_006393724.1| hypothetical protein EUTSA_v10011377mg [Eutrema salsugineum] gi|312282087|dbj|BAJ33909.1| unnamed protein product [Thellungiella halophila] gi|557090302|gb|ESQ31010.1| hypothetical protein EUTSA_v10011377mg [Eutrema salsugineum] Length = 534 Score = 40.8 bits (94), Expect(2) = 5e-06 Identities = 15/28 (53%), Positives = 22/28 (78%) Frame = +3 Query: 111 LKGGFGVFAIIGDEGGLIDRKSSWAAIF 194 +KG F VFA+ G+EGGL+++KS W +F Sbjct: 31 VKGEFRVFAVFGEEGGLVEKKSQWGPLF 58 Score = 35.0 bits (79), Expect(2) = 5e-06 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +2 Query: 197 VEDPCPNVSWYKDKFLDVNQALQVAIFGV 283 VEDP +K KFLDVNQAL+VA F + Sbjct: 60 VEDPRSKTPPFKGKFLDVNQALEVARFDI 88 >ref|XP_002306638.2| hypothetical protein POPTR_0005s20060g [Populus trichocarpa] gi|550339360|gb|EEE93634.2| hypothetical protein POPTR_0005s20060g [Populus trichocarpa] Length = 573 Score = 45.1 bits (105), Expect(2) = 6e-06 Identities = 16/28 (57%), Positives = 25/28 (89%) Frame = +3 Query: 111 LKGGFGVFAIIGDEGGLIDRKSSWAAIF 194 ++GGF VFA++G+EGGL+D+KS+W +F Sbjct: 66 VRGGFRVFAVLGEEGGLLDKKSTWGPLF 93 Score = 30.4 bits (67), Expect(2) = 6e-06 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +2 Query: 197 VEDPCPNVSWYKDKFLDVNQALQVAIFGV 283 VEDP + +K KFLD QAL+VA + + Sbjct: 95 VEDPRSKMPQFKGKFLDAYQALEVARYDI 123 >dbj|BAA82484.1| chlorophyll b synthase [Arabidopsis thaliana] Length = 536 Score = 39.7 bits (91), Expect(2) = 6e-06 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = +3 Query: 111 LKGGFGVFAIIGDEGGLIDRKSSWAAIF 194 +KG F VFA+ GDE GL+++KS W +F Sbjct: 31 VKGEFRVFAVFGDESGLVEKKSQWRPLF 58 Score = 35.8 bits (81), Expect(2) = 6e-06 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +2 Query: 197 VEDPCPNVSWYKDKFLDVNQALQVAIFGV 283 VEDP YK KFLDVNQA++VA F + Sbjct: 60 VEDPRSKAPPYKGKFLDVNQAIEVARFDI 88 >ref|XP_006307209.1| hypothetical protein CARUB_v10008806mg [Capsella rubella] gi|482575920|gb|EOA40107.1| hypothetical protein CARUB_v10008806mg [Capsella rubella] Length = 536 Score = 39.7 bits (91), Expect(2) = 6e-06 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = +3 Query: 111 LKGGFGVFAIIGDEGGLIDRKSSWAAIF 194 +KG F VFA+ GDE GL+++KS W +F Sbjct: 31 VKGEFRVFAVFGDESGLVEKKSQWRPLF 58 Score = 35.8 bits (81), Expect(2) = 6e-06 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +2 Query: 197 VEDPCPNVSWYKDKFLDVNQALQVAIFGV 283 VEDP YK KFLDVNQA++VA F + Sbjct: 60 VEDPRSKAPPYKGKFLDVNQAIEVARFDI 88 >gb|AAD54323.1| chlorophyll a oxygenase [Arabidopsis thaliana] Length = 536 Score = 39.7 bits (91), Expect(2) = 6e-06 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = +3 Query: 111 LKGGFGVFAIIGDEGGLIDRKSSWAAIF 194 +KG F VFA+ GDE GL+++KS W +F Sbjct: 31 VKGEFRVFAVFGDESGLVEKKSQWRPLF 58 Score = 35.8 bits (81), Expect(2) = 6e-06 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +2 Query: 197 VEDPCPNVSWYKDKFLDVNQALQVAIFGV 283 VEDP YK KFLDVNQA++VA F + Sbjct: 60 VEDPRSKAPPYKGKFLDVNQAIEVARFDI 88 >ref|NP_175088.1| chlorophyllide a oxygenase [Arabidopsis thaliana] gi|75264959|sp|Q9MBA1.1|CAO_ARATH RecName: Full=Chlorophyllide a oxygenase, chloroplastic; Short=Chlorophyll a oxygenase; AltName: Full=Chlorophyll b synthase; Short=AtCAO; Flags: Precursor gi|13876511|gb|AAK43487.1|AC084807_12 chlorophyll a oxygenase [Arabidopsis thaliana] gi|6855279|dbj|BAA90462.1| chlorophyll a oxygenase [Arabidopsis thaliana] gi|22135956|gb|AAM91560.1| chlorophyll a oxygenase [Arabidopsis thaliana] gi|25083487|gb|AAN72086.1| chlorophyll a oxygenase [Arabidopsis thaliana] gi|110737210|dbj|BAF00553.1| chlorophyll a oxygenase [Arabidopsis thaliana] gi|332193913|gb|AEE32034.1| chlorophyllide a oxygenase [Arabidopsis thaliana] Length = 536 Score = 39.7 bits (91), Expect(2) = 6e-06 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = +3 Query: 111 LKGGFGVFAIIGDEGGLIDRKSSWAAIF 194 +KG F VFA+ GDE GL+++KS W +F Sbjct: 31 VKGEFRVFAVFGDESGLVEKKSQWRPLF 58 Score = 35.8 bits (81), Expect(2) = 6e-06 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +2 Query: 197 VEDPCPNVSWYKDKFLDVNQALQVAIFGV 283 VEDP YK KFLDVNQA++VA F + Sbjct: 60 VEDPRSKAPPYKGKFLDVNQAIEVARFDI 88 >ref|NP_973969.1| chlorophyllide a oxygenase [Arabidopsis thaliana] gi|332193914|gb|AEE32035.1| chlorophyllide a oxygenase [Arabidopsis thaliana] Length = 511 Score = 39.7 bits (91), Expect(2) = 6e-06 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = +3 Query: 111 LKGGFGVFAIIGDEGGLIDRKSSWAAIF 194 +KG F VFA+ GDE GL+++KS W +F Sbjct: 31 VKGEFRVFAVFGDESGLVEKKSQWRPLF 58 Score = 35.8 bits (81), Expect(2) = 6e-06 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +2 Query: 197 VEDPCPNVSWYKDKFLDVNQALQVAIFGV 283 VEDP YK KFLDVNQA++VA F + Sbjct: 60 VEDPRSKAPPYKGKFLDVNQAIEVARFDI 88 >ref|NP_973970.1| chlorophyllide a oxygenase [Arabidopsis thaliana] gi|332193915|gb|AEE32036.1| chlorophyllide a oxygenase [Arabidopsis thaliana] Length = 433 Score = 39.7 bits (91), Expect(2) = 6e-06 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = +3 Query: 111 LKGGFGVFAIIGDEGGLIDRKSSWAAIF 194 +KG F VFA+ GDE GL+++KS W +F Sbjct: 31 VKGEFRVFAVFGDESGLVEKKSQWRPLF 58 Score = 35.8 bits (81), Expect(2) = 6e-06 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +2 Query: 197 VEDPCPNVSWYKDKFLDVNQALQVAIFGV 283 VEDP YK KFLDVNQA++VA F + Sbjct: 60 VEDPRSKAPPYKGKFLDVNQAIEVARFDI 88