BLASTX nr result
ID: Mentha27_contig00039546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00039546 (233 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26622.1| hypothetical protein MIMGU_mgv1a013365mg [Mimulus... 56 6e-06 >gb|EYU26622.1| hypothetical protein MIMGU_mgv1a013365mg [Mimulus guttatus] Length = 222 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/74 (36%), Positives = 39/74 (52%) Frame = -3 Query: 222 MWRACWSXXXXXXXXXXXXXEALKHLENEIXXXXXXXXXXXXXXXFAANFIAYWVPIASE 43 +W+ACWS +AL+ LENEI F+ANF+AYW I +E Sbjct: 110 VWKACWSEGEEREKAMEEASKALEFLENEIKGKKFFGGDNVGLVDFSANFLAYWCGILAE 169 Query: 42 LGGVELMSENKFPN 1 L G++ ++E K+PN Sbjct: 170 LSGLQFLTEEKYPN 183