BLASTX nr result
ID: Mentha27_contig00039302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00039302 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34399.1| hypothetical protein MIMGU_mgv1a011498mg [Mimulus... 65 1e-08 gb|EYU44639.1| hypothetical protein MIMGU_mgv1a011451mg [Mimulus... 61 1e-07 >gb|EYU34399.1| hypothetical protein MIMGU_mgv1a011498mg [Mimulus guttatus] Length = 279 Score = 64.7 bits (156), Expect = 1e-08 Identities = 37/70 (52%), Positives = 45/70 (64%), Gaps = 3/70 (4%) Frame = -3 Query: 349 KSLGSAGNAEPCMDSATEDDRQSDEGEIELELTLGFEPLSRCVK---MRSEPAGGSAAGL 179 +SLGSA AEP E DR D+ EIEL+LTLGFEP+ RC K ++ AG +AG+ Sbjct: 212 ESLGSAETAEP------EADRTDDDEEIELDLTLGFEPIKRCPKPKELKPSEAGCKSAGV 265 Query: 178 CKMELRLDCP 149 C MEL LD P Sbjct: 266 CGMELGLDYP 275 >gb|EYU44639.1| hypothetical protein MIMGU_mgv1a011451mg [Mimulus guttatus] Length = 281 Score = 61.2 bits (147), Expect = 1e-07 Identities = 34/64 (53%), Positives = 38/64 (59%), Gaps = 4/64 (6%) Frame = -3 Query: 307 SATEDDRQSDEGEIELELTLGFEPLSRCVKMR----SEPAGGSAAGLCKMELRLDCPSFV 140 SA + DEGEIEL+LTLGFEP R VK + E AGLCKMELRLDC Sbjct: 217 SAACESASEDEGEIELDLTLGFEPFKRAVKPKEVAVKEAEDDGGAGLCKMELRLDCAVRG 276 Query: 139 IDGS 128 +GS Sbjct: 277 FNGS 280