BLASTX nr result
ID: Mentha27_contig00038973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00038973 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59462.1| hypothetical protein M569_15344 [Genlisea aurea] 57 4e-06 >gb|EPS59462.1| hypothetical protein M569_15344 [Genlisea aurea] Length = 422 Score = 56.6 bits (135), Expect = 4e-06 Identities = 30/67 (44%), Positives = 38/67 (56%) Frame = +2 Query: 8 EVWRLKEIGKDGKRHERLKGKDIESVSDFLFWFHVDPEXXXXXXXXXXXXXXDSDWEAIV 187 +VWR+++IGKDG H RLK + I +V DFL FH+DP WEA V Sbjct: 257 QVWRIEKIGKDGAFHRRLKEEGINTVQDFLVLFHLDPTKLRTILGSGMSTKM---WEATV 313 Query: 188 DHAKKTC 208 DHA +TC Sbjct: 314 DHA-RTC 319