BLASTX nr result
ID: Mentha27_contig00038867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00038867 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27129.1| hypothetical protein MIMGU_mgv1a020238mg, partial... 56 6e-06 >gb|EYU27129.1| hypothetical protein MIMGU_mgv1a020238mg, partial [Mimulus guttatus] Length = 187 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/76 (36%), Positives = 39/76 (51%) Frame = -3 Query: 300 FRPWIHQHPMSRIGVESRDSFHNWCWGCWRFFIGGEAVYGCRRDECGFREVFHQECLEMP 121 F + H+HP+ V D H C GC I G A Y C + +C F + H C ++P Sbjct: 27 FSHFSHRHPLELSEVHEED--HAICSGCEHDIISGSA-YICAKPKCNF--LLHDLCFDLP 81 Query: 120 REIRHHVHPSHKLTMY 73 R IRH HP H L+++ Sbjct: 82 RRIRHRCHPKHPLSLF 97