BLASTX nr result
ID: Mentha27_contig00038848
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00038848 (279 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN33789.1| hypothetical protein [Cucumis melo subsp. melo] g... 59 7e-07 ref|XP_004137714.1| PREDICTED: uncharacterized protein LOC101211... 57 3e-06 >gb|ADN33789.1| hypothetical protein [Cucumis melo subsp. melo] gi|307136470|gb|ADN34274.1| hypothetical protein [Cucumis melo subsp. melo] Length = 355 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/81 (39%), Positives = 46/81 (56%), Gaps = 5/81 (6%) Frame = +3 Query: 21 SNCLSRILRRILCFSNLPLYSFD-----RFKVDEVECSVAIGAPDATPGVVARLMGLDSV 185 S C S ILRR+LC NLP + + +F + + E +A + ++TPGVVARLMGL S+ Sbjct: 9 SGCFSGILRRLLCTGNLPTHPSEALHESQFDIPKTEAKLAAQSAESTPGVVARLMGLSSL 68 Query: 186 PPAEPIKESPSFPESADRLKA 248 P A + P + R K+ Sbjct: 69 PDANWVPNHQVRPGAVSRSKS 89 >ref|XP_004137714.1| PREDICTED: uncharacterized protein LOC101211240 [Cucumis sativus] gi|449529660|ref|XP_004171816.1| PREDICTED: uncharacterized LOC101211240 [Cucumis sativus] Length = 353 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 5/81 (6%) Frame = +3 Query: 21 SNCLSRILRRILCFSNLPLYSFD-----RFKVDEVECSVAIGAPDATPGVVARLMGLDSV 185 S C S ILRR+LC NLP + + +F + + E + + ++TPGVVARLMGL S+ Sbjct: 9 SCCFSGILRRLLCTGNLPTHPSEALNDSQFDIPKTEAKLVAQSAESTPGVVARLMGLSSL 68 Query: 186 PPAEPIKESPSFPESADRLKA 248 P A + + P + R K+ Sbjct: 69 PDANWVPNHRARPGAVSRSKS 89