BLASTX nr result
ID: Mentha27_contig00038780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00038780 (242 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24551.1| hypothetical protein MIMGU_mgv1a000021mg [Mimulus... 57 2e-06 gb|EYU26032.1| hypothetical protein MIMGU_mgv1a000015mg [Mimulus... 56 5e-06 gb|EYU26027.1| hypothetical protein MIMGU_mgv1a024392mg, partial... 56 5e-06 gb|EYU30324.1| hypothetical protein MIMGU_mgv1a026486mg, partial... 56 6e-06 >gb|EYU24551.1| hypothetical protein MIMGU_mgv1a000021mg [Mimulus guttatus] Length = 2517 Score = 57.4 bits (137), Expect = 2e-06 Identities = 38/88 (43%), Positives = 53/88 (60%), Gaps = 8/88 (9%) Frame = +2 Query: 2 RLLMILCLLTINWRLYFDILDEMMP*ADIKSQLPREFYKALRTNGMT-FMQLVSAIATAF 178 RL MILCLL +N L FD L E++ IKSQLP FY+A+R M ++ +A+A AF Sbjct: 2175 RLFMILCLLCLNSELPFDALLEVLKVYYIKSQLPLRFYEAIRLKRMNKYVSCETAVAAAF 2234 Query: 179 K-----LIVVPN--EISRRFPYPDAVFL 241 K L++V + + S F P+A+FL Sbjct: 2235 KTIGDSLVIVASTEDSSLEFVCPNAIFL 2262 >gb|EYU26032.1| hypothetical protein MIMGU_mgv1a000015mg [Mimulus guttatus] Length = 2666 Score = 56.2 bits (134), Expect = 5e-06 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 8/88 (9%) Frame = +2 Query: 2 RLLMILCLLTINWRLYFDILDEMMP*ADIKSQLPREFYKALRTNGMTFMQLVSAIATAFK 181 RL MILCL +N L F++L +++ A I++QLP +F +A+R M + SA+A AF Sbjct: 2345 RLFMILCLSCLNSELSFNVLFDVLKVAHIRNQLPWKFCEAIRCRRMNNVSDESAVAGAFN 2404 Query: 182 LIVVP------NEISRRFPY--PDAVFL 241 +I P NE SRR + P+AVFL Sbjct: 2405 IIGDPLVIIGSNENSRRLEFLCPNAVFL 2432 >gb|EYU26027.1| hypothetical protein MIMGU_mgv1a024392mg, partial [Mimulus guttatus] Length = 1028 Score = 56.2 bits (134), Expect = 5e-06 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 8/88 (9%) Frame = +2 Query: 2 RLLMILCLLTINWRLYFDILDEMMP*ADIKSQLPREFYKALRTNGMTFMQLVSAIATAFK 181 RL MILCL +N L F++L +++ A I++QLP +F +A+R M + SA+A AF Sbjct: 707 RLFMILCLSCLNSELSFNVLFDVLKVAHIRNQLPWKFCEAIRCRRMNNVSDESAVAGAFN 766 Query: 182 LIVVP------NEISRRFPY--PDAVFL 241 +I P NE SRR + P+AVFL Sbjct: 767 IIGDPLVIIGSNENSRRLEFLCPNAVFL 794 >gb|EYU30324.1| hypothetical protein MIMGU_mgv1a026486mg, partial [Mimulus guttatus] Length = 822 Score = 55.8 bits (133), Expect = 6e-06 Identities = 37/87 (42%), Positives = 50/87 (57%), Gaps = 7/87 (8%) Frame = +2 Query: 2 RLLMILCLLTINWRLYFDILDEMMP*ADIKSQLPREFYKALRTNGMTFMQLVSAIATAFK 181 RL +ILCL +N L F++L E++ IK QLPR F +A+R + +A+A AF Sbjct: 668 RLFVILCLTCLNSELSFNVLFEVLKVPHIKCQLPRNFCEAIRCRRTNNVSDEAAVAGAFN 727 Query: 182 L------IVVPNEISR-RFPYPDAVFL 241 + IV NE SR +F PDAVFL Sbjct: 728 IIGDPLVIVASNENSRLKFVCPDAVFL 754