BLASTX nr result
ID: Mentha27_contig00038620
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00038620 (271 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41565.1| hypothetical protein MIMGU_mgv1a026878mg, partial... 110 2e-22 gb|EXB75955.1| hypothetical protein L484_022634 [Morus notabilis] 80 3e-13 gb|EPS58257.1| hypothetical protein M569_16559 [Genlisea aurea] 79 7e-13 ref|XP_002277923.1| PREDICTED: pentatricopeptide repeat-containi... 72 8e-11 emb|CBI30210.3| unnamed protein product [Vitis vinifera] 72 8e-11 ref|XP_004305376.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 ref|XP_002528626.1| pentatricopeptide repeat-containing protein,... 70 3e-10 emb|CAN82063.1| hypothetical protein VITISV_016431 [Vitis vinifera] 70 3e-10 ref|XP_006347831.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 ref|XP_004231252.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 ref|XP_002323489.2| hypothetical protein POPTR_0016s11000g [Popu... 69 7e-10 ref|XP_006481930.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_006430347.1| hypothetical protein CICLE_v10011036mg [Citr... 68 2e-09 ref|XP_007203128.1| hypothetical protein PRUPE_ppa024044mg [Prun... 67 3e-09 ref|XP_004156326.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_004143370.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_006402229.1| hypothetical protein EUTSA_v10015790mg [Eutr... 67 3e-09 ref|XP_002873115.1| EMB175 [Arabidopsis lyrata subsp. lyrata] gi... 66 4e-09 ref|NP_196000.2| pentatricopeptide repeat protein EMB175 [Arabid... 66 6e-09 emb|CAB85500.1| putative protein [Arabidopsis thaliana] 66 6e-09 >gb|EYU41565.1| hypothetical protein MIMGU_mgv1a026878mg, partial [Mimulus guttatus] Length = 722 Score = 110 bits (275), Expect = 2e-22 Identities = 56/73 (76%), Positives = 64/73 (87%) Frame = -2 Query: 219 ITRLLKFSRDYADIQLGKALHASIIKVRQDVRLCNSLISSYIELGHLNYAGRVFNSILKP 40 ++RLLK S +YADIQLGKA+HAS++K QDVRL NSLI+SY ELG LNYA RVF+SIL P Sbjct: 1 LSRLLKLSIEYADIQLGKAVHASVLKFEQDVRLFNSLITSYFELGKLNYAERVFDSILAP 60 Query: 39 DVVSYTAMISGLA 1 DVVSYTAMISGLA Sbjct: 61 DVVSYTAMISGLA 73 >gb|EXB75955.1| hypothetical protein L484_022634 [Morus notabilis] Length = 911 Score = 80.1 bits (196), Expect = 3e-13 Identities = 40/82 (48%), Positives = 58/82 (70%) Frame = -2 Query: 246 NFQPLSHDEITRLLKFSRDYADIQLGKALHASIIKVRQDVRLCNSLISSYIELGHLNYAG 67 NF D + LL+ S Y D++L KA+HAS++K+ +DV L NSLIS+Y++LG ++ A Sbjct: 94 NFVEFDVDGLLHLLQLSVRYNDVELAKAVHASVVKLGEDVYLGNSLISAYLKLGFVSEAY 153 Query: 66 RVFNSILKPDVVSYTAMISGLA 1 VF ++ PD+VSYTAMISG + Sbjct: 154 EVFMAMASPDLVSYTAMISGFS 175 >gb|EPS58257.1| hypothetical protein M569_16559 [Genlisea aurea] Length = 846 Score = 79.0 bits (193), Expect = 7e-13 Identities = 41/81 (50%), Positives = 60/81 (74%), Gaps = 1/81 (1%) Frame = -2 Query: 240 QPLSHDEITRLLKFSRDYADIQLGKALHASIIKVRQD-VRLCNSLISSYIELGHLNYAGR 64 +P S+ +++RLLK S +Y D+ KA+HASI++ +D +RL NSL+++Y+ LG +N A Sbjct: 33 RPPSNGDLSRLLKLSIEYGDVNFCKAVHASILRGEEDDIRLQNSLVTAYLRLGRVNDAES 92 Query: 63 VFNSILKPDVVSYTAMISGLA 1 VF+SI PDVVS+TAMIS A Sbjct: 93 VFDSIPCPDVVSHTAMISAFA 113 >ref|XP_002277923.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Vitis vinifera] Length = 882 Score = 72.0 bits (175), Expect = 8e-11 Identities = 40/85 (47%), Positives = 57/85 (67%), Gaps = 3/85 (3%) Frame = -2 Query: 246 NFQPLSHDEITR---LLKFSRDYADIQLGKALHASIIKVRQDVRLCNSLISSYIELGHLN 76 NF +S+D + LL S Y D++L KA+HASI K+ +D+ L N+LI +Y++LG + Sbjct: 63 NFPSVSNDTVNDHYYLLDLSVRYDDVELIKAVHASIFKLAEDIHLANALIVAYLKLGMVP 122 Query: 75 YAGRVFNSILKPDVVSYTAMISGLA 1 A +VF + P+VVSYTAMISG A Sbjct: 123 NAYKVFVGLSCPNVVSYTAMISGFA 147 >emb|CBI30210.3| unnamed protein product [Vitis vinifera] Length = 900 Score = 72.0 bits (175), Expect = 8e-11 Identities = 40/85 (47%), Positives = 57/85 (67%), Gaps = 3/85 (3%) Frame = -2 Query: 246 NFQPLSHDEITR---LLKFSRDYADIQLGKALHASIIKVRQDVRLCNSLISSYIELGHLN 76 NF +S+D + LL S Y D++L KA+HASI K+ +D+ L N+LI +Y++LG + Sbjct: 81 NFPSVSNDTVNDHYYLLDLSVRYDDVELIKAVHASIFKLAEDIHLANALIVAYLKLGMVP 140 Query: 75 YAGRVFNSILKPDVVSYTAMISGLA 1 A +VF + P+VVSYTAMISG A Sbjct: 141 NAYKVFVGLSCPNVVSYTAMISGFA 165 >ref|XP_004305376.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like, partial [Fragaria vesca subsp. vesca] Length = 807 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/70 (48%), Positives = 50/70 (71%) Frame = -2 Query: 210 LLKFSRDYADIQLGKALHASIIKVRQDVRLCNSLISSYIELGHLNYAGRVFNSILKPDVV 31 LL+ S +AD L +A+HAS +K+ D L N+L+S+Y++LG + A RVF S+ P+VV Sbjct: 1 LLRLSARHADADLARAVHASALKLESDTHLGNALVSAYLKLGLVPQAYRVFQSLPSPNVV 60 Query: 30 SYTAMISGLA 1 S+TAM+SG A Sbjct: 61 SFTAMVSGFA 70 >ref|XP_002528626.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531915|gb|EEF33729.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 537 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/83 (42%), Positives = 52/83 (62%) Frame = -2 Query: 249 DNFQPLSHDEITRLLKFSRDYADIQLGKALHASIIKVRQDVRLCNSLISSYIELGHLNYA 70 D F + D + LL+ S Y D L +ALHASI+K+ +D L N+L+ +Y++LG + A Sbjct: 78 DTFIDIGIDHLLNLLRISVRYTDFDLARALHASILKLGEDTHLGNALVVAYLKLGLVLDA 137 Query: 69 GRVFNSILKPDVVSYTAMISGLA 1 VF + PDVVSY+++IS A Sbjct: 138 YEVFKGLCNPDVVSYSSLISSFA 160 >emb|CAN82063.1| hypothetical protein VITISV_016431 [Vitis vinifera] Length = 755 Score = 70.1 bits (170), Expect = 3e-10 Identities = 36/70 (51%), Positives = 50/70 (71%) Frame = -2 Query: 210 LLKFSRDYADIQLGKALHASIIKVRQDVRLCNSLISSYIELGHLNYAGRVFNSILKPDVV 31 LL S Y D++L KA+HASI K+ +D+ L N+LI +Y++LG + A +VF + P+VV Sbjct: 80 LLDLSVRYDDVELIKAVHASIFKLAEDIHLANALIVAYLKLGMVXNAXKVFVGLSCPNVV 139 Query: 30 SYTAMISGLA 1 SYTAMISG A Sbjct: 140 SYTAMISGFA 149 >ref|XP_006347831.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Solanum tuberosum] Length = 894 Score = 69.7 bits (169), Expect = 4e-10 Identities = 37/75 (49%), Positives = 53/75 (70%), Gaps = 1/75 (1%) Frame = -2 Query: 222 EITRLLKFSRDYADIQLGKALHASIIKVRQ-DVRLCNSLISSYIELGHLNYAGRVFNSIL 46 + LL+ S D+ L K +H+S++K + DV L N+LI++YI+LG LN A RVF+S++ Sbjct: 83 DYANLLRISVRCGDVVLTKIIHSSLVKFEEEDVYLKNALIAAYIKLGCLNLAERVFDSLM 142 Query: 45 KPDVVSYTAMISGLA 1 PDVVSYTA+IS A Sbjct: 143 SPDVVSYTAIISAFA 157 >ref|XP_004231252.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Solanum lycopersicum] Length = 891 Score = 69.7 bits (169), Expect = 4e-10 Identities = 37/75 (49%), Positives = 53/75 (70%), Gaps = 1/75 (1%) Frame = -2 Query: 222 EITRLLKFSRDYADIQLGKALHASIIKVRQ-DVRLCNSLISSYIELGHLNYAGRVFNSIL 46 + LL+ S D++L K +H+S++K + DV L N+LI++YI+LG LN A RVF+S+ Sbjct: 80 DYANLLRISVRCGDVELTKIIHSSLVKFEEEDVYLKNALIAAYIKLGCLNLAERVFDSLR 139 Query: 45 KPDVVSYTAMISGLA 1 PDVVSYTA+IS A Sbjct: 140 SPDVVSYTAIISAFA 154 >ref|XP_002323489.2| hypothetical protein POPTR_0016s11000g [Populus trichocarpa] gi|550321242|gb|EEF05250.2| hypothetical protein POPTR_0016s11000g [Populus trichocarpa] Length = 915 Score = 68.9 bits (167), Expect = 7e-10 Identities = 35/75 (46%), Positives = 52/75 (69%) Frame = -2 Query: 225 DEITRLLKFSRDYADIQLGKALHASIIKVRQDVRLCNSLISSYIELGHLNYAGRVFNSIL 46 D++ LL+ S Y DI L +ALHASI+K+ +D L N++I++YI+LG + A VF + Sbjct: 105 DDLFNLLRLSVKYTDIDLARALHASILKLGEDTHLGNAVIAAYIKLGLVVDAYEVFMGMS 164 Query: 45 KPDVVSYTAMISGLA 1 PDVVSY+A+IS + Sbjct: 165 TPDVVSYSALISSFS 179 >ref|XP_006481930.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Citrus sinensis] Length = 893 Score = 67.8 bits (164), Expect = 2e-09 Identities = 35/92 (38%), Positives = 57/92 (61%), Gaps = 2/92 (2%) Frame = -2 Query: 270 ILTPKHPDNFQPLSHDEITRLLKFSRDYADIQLGKALHASIIKV--RQDVRLCNSLISSY 97 +++P + D L+ S ++ L KA+HAS+IK+ QD R N LIS+Y Sbjct: 65 VVSPSSNTKVIDVDVDSFFNSLRLSVQCGEVSLAKAIHASLIKLLLEQDTRFGNPLISAY 124 Query: 96 IELGHLNYAGRVFNSILKPDVVSYTAMISGLA 1 ++LGH++ A ++F + P+VVS+T++ISGLA Sbjct: 125 LKLGHVSDAYKIFYGLSSPNVVSFTSLISGLA 156 >ref|XP_006430347.1| hypothetical protein CICLE_v10011036mg [Citrus clementina] gi|557532404|gb|ESR43587.1| hypothetical protein CICLE_v10011036mg [Citrus clementina] Length = 893 Score = 67.8 bits (164), Expect = 2e-09 Identities = 35/92 (38%), Positives = 57/92 (61%), Gaps = 2/92 (2%) Frame = -2 Query: 270 ILTPKHPDNFQPLSHDEITRLLKFSRDYADIQLGKALHASIIKV--RQDVRLCNSLISSY 97 +++P + D L+ S ++ L KA+HAS+IK+ QD R N LIS+Y Sbjct: 65 VVSPSSNTKVIDVDVDSFFNSLRLSVQCGEVSLAKAIHASLIKLLLEQDTRFGNPLISAY 124 Query: 96 IELGHLNYAGRVFNSILKPDVVSYTAMISGLA 1 ++LGH++ A ++F + P+VVS+T++ISGLA Sbjct: 125 LKLGHVSDAYKIFYGLSSPNVVSFTSLISGLA 156 >ref|XP_007203128.1| hypothetical protein PRUPE_ppa024044mg [Prunus persica] gi|462398659|gb|EMJ04327.1| hypothetical protein PRUPE_ppa024044mg [Prunus persica] Length = 905 Score = 67.0 bits (162), Expect = 3e-09 Identities = 37/92 (40%), Positives = 57/92 (61%), Gaps = 3/92 (3%) Frame = -2 Query: 267 LTPKHPDNFQPLSH---DEITRLLKFSRDYADIQLGKALHASIIKVRQDVRLCNSLISSY 97 L P P N +H + LL+ S + D +L +A+HASI+K +D L N+LIS+Y Sbjct: 78 LLPLTPPNGSDQTHFLFHHLLNLLRLSARHGDHELARAVHASILKFEEDNHLGNALISAY 137 Query: 96 IELGHLNYAGRVFNSILKPDVVSYTAMISGLA 1 ++LG + A RVF S+ P+VVS+T ++SG + Sbjct: 138 LKLGLVPDAYRVFQSLSCPNVVSFTTLVSGFS 169 >ref|XP_004156326.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Cucumis sativus] Length = 908 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/70 (45%), Positives = 50/70 (71%) Frame = -2 Query: 210 LLKFSRDYADIQLGKALHASIIKVRQDVRLCNSLISSYIELGHLNYAGRVFNSILKPDVV 31 LL+ S Y D L +A+HA +K+ +D+ L N+LIS+Y++LG + A +VF+ + P+VV Sbjct: 103 LLRLSTRYGDPDLARAVHAQFLKLEEDIFLGNALISAYLKLGLVRDADKVFSGLSCPNVV 162 Query: 30 SYTAMISGLA 1 SYTA+ISG + Sbjct: 163 SYTALISGFS 172 >ref|XP_004143370.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Cucumis sativus] Length = 908 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/70 (45%), Positives = 50/70 (71%) Frame = -2 Query: 210 LLKFSRDYADIQLGKALHASIIKVRQDVRLCNSLISSYIELGHLNYAGRVFNSILKPDVV 31 LL+ S Y D L +A+HA +K+ +D+ L N+LIS+Y++LG + A +VF+ + P+VV Sbjct: 103 LLRLSTRYGDPDLARAVHAQFLKLEEDIFLGNALISAYLKLGLVRDADKVFSGLSCPNVV 162 Query: 30 SYTAMISGLA 1 SYTA+ISG + Sbjct: 163 SYTALISGFS 172 >ref|XP_006402229.1| hypothetical protein EUTSA_v10015790mg [Eutrema salsugineum] gi|557103319|gb|ESQ43682.1| hypothetical protein EUTSA_v10015790mg [Eutrema salsugineum] Length = 831 Score = 66.6 bits (161), Expect = 3e-09 Identities = 36/71 (50%), Positives = 51/71 (71%), Gaps = 1/71 (1%) Frame = -2 Query: 210 LLKFSRDYADIQLGKALHASIIKVRQD-VRLCNSLISSYIELGHLNYAGRVFNSILKPDV 34 LL+ S Y D+++ KA+HAS +K+R++ + L NSLIS+Y++LG A VF S+ P V Sbjct: 86 LLRLSAQYHDVEVTKAVHASFLKLREETIDLGNSLISAYLKLGFPRDAFLVFVSLSSPTV 145 Query: 33 VSYTAMISGLA 1 VSYTA+ISG A Sbjct: 146 VSYTALISGFA 156 >ref|XP_002873115.1| EMB175 [Arabidopsis lyrata subsp. lyrata] gi|297318952|gb|EFH49374.1| EMB175 [Arabidopsis lyrata subsp. lyrata] Length = 896 Score = 66.2 bits (160), Expect = 4e-09 Identities = 35/71 (49%), Positives = 51/71 (71%), Gaps = 1/71 (1%) Frame = -2 Query: 210 LLKFSRDYADIQLGKALHASIIKVRQD-VRLCNSLISSYIELGHLNYAGRVFNSILKPDV 34 LL+ S Y D+++ KA+HAS +K+R++ RL N+LIS+Y++LG A VF S+ P V Sbjct: 86 LLRLSAQYHDVEVTKAVHASFLKLREEKTRLGNALISTYLKLGFPREAFLVFVSLSSPTV 145 Query: 33 VSYTAMISGLA 1 VSYTA+ISG + Sbjct: 146 VSYTALISGFS 156 >ref|NP_196000.2| pentatricopeptide repeat protein EMB175 [Arabidopsis thaliana] gi|75170265|sp|Q9FFN1.1|PP363_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g03800; AltName: Full=Protein EMBRYO DEFECTIVE 175 gi|9758009|dbj|BAB08606.1| selenium-binding protein-like [Arabidopsis thaliana] gi|26449508|dbj|BAC41880.1| unknown protein [Arabidopsis thaliana] gi|58013014|gb|AAW62960.1| embryo-defective 175 [Arabidopsis thaliana] gi|58013016|gb|AAW62961.1| embryo-defective 175 [Arabidopsis thaliana] gi|332003273|gb|AED90656.1| pentatricopeptide repeat protein EMB175 [Arabidopsis thaliana] gi|591401840|gb|AHL38647.1| glycosyltransferase, partial [Arabidopsis thaliana] Length = 896 Score = 65.9 bits (159), Expect = 6e-09 Identities = 35/71 (49%), Positives = 51/71 (71%), Gaps = 1/71 (1%) Frame = -2 Query: 210 LLKFSRDYADIQLGKALHASIIKVRQD-VRLCNSLISSYIELGHLNYAGRVFNSILKPDV 34 LL+ S Y D+++ KA+HAS +K+R++ RL N+LIS+Y++LG A VF S+ P V Sbjct: 86 LLRLSAQYHDVEVTKAVHASFLKLREEKTRLGNALISTYLKLGFPREAILVFVSLSSPTV 145 Query: 33 VSYTAMISGLA 1 VSYTA+ISG + Sbjct: 146 VSYTALISGFS 156 >emb|CAB85500.1| putative protein [Arabidopsis thaliana] Length = 837 Score = 65.9 bits (159), Expect = 6e-09 Identities = 35/71 (49%), Positives = 51/71 (71%), Gaps = 1/71 (1%) Frame = -2 Query: 210 LLKFSRDYADIQLGKALHASIIKVRQD-VRLCNSLISSYIELGHLNYAGRVFNSILKPDV 34 LL+ S Y D+++ KA+HAS +K+R++ RL N+LIS+Y++LG A VF S+ P V Sbjct: 86 LLRLSAQYHDVEVTKAVHASFLKLREEKTRLGNALISTYLKLGFPREAILVFVSLSSPTV 145 Query: 33 VSYTAMISGLA 1 VSYTA+ISG + Sbjct: 146 VSYTALISGFS 156