BLASTX nr result
ID: Mentha27_contig00037899
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00037899 (295 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006340462.1| PREDICTED: protein IQ-DOMAIN 1-like isoform ... 63 5e-08 ref|XP_006340461.1| PREDICTED: protein IQ-DOMAIN 1-like isoform ... 63 5e-08 ref|XP_004237517.1| PREDICTED: protein IQ-DOMAIN 1-like [Solanum... 61 1e-07 ref|XP_002529709.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 ref|XP_007162725.1| hypothetical protein PHAVU_001G175100g [Phas... 57 4e-06 >ref|XP_006340462.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Solanum tuberosum] Length = 459 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = +3 Query: 159 GRVRPQSPRGGMCTDDDSKSLTSTQSEQCRRRSYAGSSVRDDESL 293 GR+RP SPR DDDS+S+TS QSE+CRR S AGSS+RDDESL Sbjct: 349 GRIRPASPRVSN-VDDDSRSMTSAQSERCRRHSIAGSSIRDDESL 392 >ref|XP_006340461.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Solanum tuberosum] Length = 460 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = +3 Query: 159 GRVRPQSPRGGMCTDDDSKSLTSTQSEQCRRRSYAGSSVRDDESL 293 GR+RP SPR DDDS+S+TS QSE+CRR S AGSS+RDDESL Sbjct: 350 GRIRPASPRVSN-VDDDSRSMTSAQSERCRRHSIAGSSIRDDESL 393 >ref|XP_004237517.1| PREDICTED: protein IQ-DOMAIN 1-like [Solanum lycopersicum] Length = 460 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = +3 Query: 159 GRVRPQSPRGGMCTDDDSKSLTSTQSEQCRRRSYAGSSVRDDESL 293 GR+RP SPR DDDS+S+ S QSE+CRR S AGSSVRDDESL Sbjct: 350 GRIRPASPRVSN-VDDDSRSMASAQSERCRRHSIAGSSVRDDESL 393 >ref|XP_002529709.1| conserved hypothetical protein [Ricinus communis] gi|223530811|gb|EEF32675.1| conserved hypothetical protein [Ricinus communis] Length = 461 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = +3 Query: 159 GRVRPQSPRGGMCT-DDDSKSLTSTQSEQCRRRSYAGSSVRDDESL 293 G+++P SPRG DDDS+SL S QSE+ RR S AGSSVRDDESL Sbjct: 329 GKIKPPSPRGSAWGGDDDSRSLFSVQSERYRRHSIAGSSVRDDESL 374 >ref|XP_007162725.1| hypothetical protein PHAVU_001G175100g [Phaseolus vulgaris] gi|561036189|gb|ESW34719.1| hypothetical protein PHAVU_001G175100g [Phaseolus vulgaris] Length = 475 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +3 Query: 177 SPRGGMCTDDDSKSLTSTQSEQCRRRSYAGSSVRDDESL 293 SPRG TD+DSKSL S QS++ RR S AGSSVRDDESL Sbjct: 358 SPRGSWITDEDSKSLVSVQSDRFRRHSIAGSSVRDDESL 396