BLASTX nr result
ID: Mentha27_contig00037772
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00037772 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21523.1| hypothetical protein MIMGU_mgv1a019717mg, partial... 57 3e-06 gb|EPS67423.1| hypothetical protein M569_07352 [Genlisea aurea] 57 3e-06 >gb|EYU21523.1| hypothetical protein MIMGU_mgv1a019717mg, partial [Mimulus guttatus] Length = 348 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/53 (54%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = +1 Query: 1 QQLTSREDTKAWVESYALDLPQFRSDFGLAMFKLTHLQ-GRPKEGEVRLHCRK 156 QQLTS + + WV++YA DL F+ DFGLAM KL++L GEVRL+CRK Sbjct: 296 QQLTSMAEAQVWVQAYASDLSLFKRDFGLAMMKLSNLHLLNASVGEVRLNCRK 348 >gb|EPS67423.1| hypothetical protein M569_07352 [Genlisea aurea] Length = 385 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/55 (50%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 1 QQLTSREDTKAWVESYALDLPQFRSDFGLAMFKLTHLQGRPKE-GEVRLHCRKAN 162 QQLTS E+T++WV YA D F++DFG AM KL+ LQ G+VRL+C + N Sbjct: 331 QQLTSGEETESWVRRYASDTTLFQTDFGRAMIKLSSLQNATSSTGQVRLNCSRVN 385