BLASTX nr result
ID: Mentha27_contig00037748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00037748 (389 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlise... 85 1e-14 >gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlisea aurea] Length = 56 Score = 84.7 bits (208), Expect = 1e-14 Identities = 42/57 (73%), Positives = 49/57 (85%) Frame = +2 Query: 170 RDVAQLGSAFVLGTKCHGFKSCHPYLLLPR*AVTRNQLRSFQIALRGIVHFYETIEY 340 RDVAQLGSAFVLGTKCHGFKSCHPYLLL + AV++N++RS +IA +FYETIEY Sbjct: 1 RDVAQLGSAFVLGTKCHGFKSCHPYLLLLKRAVSQNKVRSIEIA--RTPYFYETIEY 55