BLASTX nr result
ID: Mentha27_contig00037662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00037662 (669 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24156.1| hypothetical protein MIMGU_mgv1a010260mg [Mimulus... 61 3e-07 gb|EYU24150.1| hypothetical protein MIMGU_mgv1a012608mg [Mimulus... 61 3e-07 >gb|EYU24156.1| hypothetical protein MIMGU_mgv1a010260mg [Mimulus guttatus] Length = 318 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 580 IPFSVILKDPKEKNLGKFYETFHGGNISIQ 669 IPFSVILKDPKE+NL KFYETFHGGNISIQ Sbjct: 89 IPFSVILKDPKEENLEKFYETFHGGNISIQ 118 >gb|EYU24150.1| hypothetical protein MIMGU_mgv1a012608mg [Mimulus guttatus] Length = 245 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 580 IPFSVILKDPKEKNLGKFYETFHGGNISIQ 669 IPFSVILKDPKE+NL KFYETFHGGNISIQ Sbjct: 16 IPFSVILKDPKEENLEKFYETFHGGNISIQ 45