BLASTX nr result
ID: Mentha27_contig00037645
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00037645 (338 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006422485.1| hypothetical protein CICLE_v10028096mg [Citr... 61 1e-07 ref|XP_006486652.1| PREDICTED: rop guanine nucleotide exchange f... 60 4e-07 ref|XP_006364517.1| PREDICTED: rop guanine nucleotide exchange f... 60 4e-07 ref|XP_006422484.1| hypothetical protein CICLE_v10028096mg [Citr... 60 4e-07 ref|XP_007041712.1| Rho guanyl-nucleotide exchange factor 1 [The... 60 4e-07 ref|XP_004231073.1| PREDICTED: rop guanine nucleotide exchange f... 60 4e-07 ref|XP_002282312.1| PREDICTED: rop guanine nucleotide exchange f... 60 4e-07 gb|EYU38000.1| hypothetical protein MIMGU_mgv1a003780mg [Mimulus... 58 1e-06 gb|EXB95362.1| Rop guanine nucleotide exchange factor 1 [Morus n... 57 3e-06 ref|XP_007199773.1| hypothetical protein PRUPE_ppa003680mg [Prun... 57 3e-06 ref|XP_004139953.1| PREDICTED: rop guanine nucleotide exchange f... 56 5e-06 gb|EPS71259.1| hypothetical protein M569_03494 [Genlisea aurea] 56 6e-06 ref|XP_002528427.1| Rop guanine nucleotide exchange factor, puta... 56 6e-06 ref|XP_002306208.1| hypothetical protein POPTR_0004s18640g [Popu... 55 8e-06 ref|XP_001780624.1| predicted protein [Physcomitrella patens] gi... 55 8e-06 >ref|XP_006422485.1| hypothetical protein CICLE_v10028096mg [Citrus clementina] gi|557524419|gb|ESR35725.1| hypothetical protein CICLE_v10028096mg [Citrus clementina] Length = 448 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 336 RAETLLHSLRLRFPGLPQPALDMSKIQYNKV 244 RAETLLHSLRLRFPGLPQ ALDM+KIQYNKV Sbjct: 402 RAETLLHSLRLRFPGLPQTALDMNKIQYNKV 432 >ref|XP_006486652.1| PREDICTED: rop guanine nucleotide exchange factor 1-like [Citrus sinensis] Length = 574 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 336 RAETLLHSLRLRFPGLPQPALDMSKIQYNK 247 RAETLLHSLRLRFPGLPQ ALDM+KIQYNK Sbjct: 402 RAETLLHSLRLRFPGLPQTALDMNKIQYNK 431 >ref|XP_006364517.1| PREDICTED: rop guanine nucleotide exchange factor 1-like [Solanum tuberosum] Length = 577 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 336 RAETLLHSLRLRFPGLPQPALDMSKIQYNK 247 RAETLLHSLRLRFPGLPQ ALDM+KIQYNK Sbjct: 407 RAETLLHSLRLRFPGLPQTALDMNKIQYNK 436 >ref|XP_006422484.1| hypothetical protein CICLE_v10028096mg [Citrus clementina] gi|557524418|gb|ESR35724.1| hypothetical protein CICLE_v10028096mg [Citrus clementina] Length = 574 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 336 RAETLLHSLRLRFPGLPQPALDMSKIQYNK 247 RAETLLHSLRLRFPGLPQ ALDM+KIQYNK Sbjct: 402 RAETLLHSLRLRFPGLPQTALDMNKIQYNK 431 >ref|XP_007041712.1| Rho guanyl-nucleotide exchange factor 1 [Theobroma cacao] gi|508705647|gb|EOX97543.1| Rho guanyl-nucleotide exchange factor 1 [Theobroma cacao] Length = 573 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 336 RAETLLHSLRLRFPGLPQPALDMSKIQYNK 247 RAETLLHSLRLRFPGLPQ ALDM+KIQYNK Sbjct: 401 RAETLLHSLRLRFPGLPQTALDMNKIQYNK 430 >ref|XP_004231073.1| PREDICTED: rop guanine nucleotide exchange factor 1-like [Solanum lycopersicum] Length = 577 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 336 RAETLLHSLRLRFPGLPQPALDMSKIQYNK 247 RAETLLHSLRLRFPGLPQ ALDM+KIQYNK Sbjct: 407 RAETLLHSLRLRFPGLPQTALDMNKIQYNK 436 >ref|XP_002282312.1| PREDICTED: rop guanine nucleotide exchange factor 1 [Vitis vinifera] gi|297744497|emb|CBI37759.3| unnamed protein product [Vitis vinifera] Length = 587 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 336 RAETLLHSLRLRFPGLPQPALDMSKIQYNK 247 RAETLLHSLRLRFPGLPQ ALDM+KIQYNK Sbjct: 404 RAETLLHSLRLRFPGLPQTALDMNKIQYNK 433 >gb|EYU38000.1| hypothetical protein MIMGU_mgv1a003780mg [Mimulus guttatus] Length = 564 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 336 RAETLLHSLRLRFPGLPQPALDMSKIQYNK 247 RAETLLHSLR RFPGLPQ ALDMSKIQYNK Sbjct: 392 RAETLLHSLRHRFPGLPQTALDMSKIQYNK 421 >gb|EXB95362.1| Rop guanine nucleotide exchange factor 1 [Morus notabilis] Length = 571 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 336 RAETLLHSLRLRFPGLPQPALDMSKIQYNK 247 RAETLLHSLR RFPGLPQ ALDM+KIQYNK Sbjct: 399 RAETLLHSLRHRFPGLPQTALDMNKIQYNK 428 >ref|XP_007199773.1| hypothetical protein PRUPE_ppa003680mg [Prunus persica] gi|462395173|gb|EMJ00972.1| hypothetical protein PRUPE_ppa003680mg [Prunus persica] Length = 557 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 336 RAETLLHSLRLRFPGLPQPALDMSKIQYNK 247 RAETLLHSLR RFPGLPQ ALDM+KIQYNK Sbjct: 397 RAETLLHSLRHRFPGLPQTALDMNKIQYNK 426 >ref|XP_004139953.1| PREDICTED: rop guanine nucleotide exchange factor 1-like [Cucumis sativus] gi|449475751|ref|XP_004154542.1| PREDICTED: rop guanine nucleotide exchange factor 1-like [Cucumis sativus] Length = 570 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 336 RAETLLHSLRLRFPGLPQPALDMSKIQYNK 247 RAETLL SLRLRFPGLPQ ALDM+KIQYNK Sbjct: 396 RAETLLDSLRLRFPGLPQTALDMAKIQYNK 425 >gb|EPS71259.1| hypothetical protein M569_03494 [Genlisea aurea] Length = 557 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -3 Query: 336 RAETLLHSLRLRFPGLPQPALDMSKIQYNK 247 RAE LL SLRLRFPGLPQ ALDMSKIQYNK Sbjct: 387 RAENLLQSLRLRFPGLPQTALDMSKIQYNK 416 >ref|XP_002528427.1| Rop guanine nucleotide exchange factor, putative [Ricinus communis] gi|223532163|gb|EEF33969.1| Rop guanine nucleotide exchange factor, putative [Ricinus communis] Length = 580 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -3 Query: 336 RAETLLHSLRLRFPGLPQPALDMSKIQYNK 247 RAETLL SLRLRFPGLPQ ALDM KIQYNK Sbjct: 408 RAETLLQSLRLRFPGLPQTALDMHKIQYNK 437 >ref|XP_002306208.1| hypothetical protein POPTR_0004s18640g [Populus trichocarpa] gi|222849172|gb|EEE86719.1| hypothetical protein POPTR_0004s18640g [Populus trichocarpa] Length = 576 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 336 RAETLLHSLRLRFPGLPQPALDMSKIQYNK 247 RAETLL SLRLR+PGLPQ ALDM+KIQYNK Sbjct: 405 RAETLLQSLRLRYPGLPQTALDMNKIQYNK 434 >ref|XP_001780624.1| predicted protein [Physcomitrella patens] gi|162667892|gb|EDQ54510.1| predicted protein [Physcomitrella patens] Length = 371 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 336 RAETLLHSLRLRFPGLPQPALDMSKIQYNK 247 +AET+LH+L+LRFPGLPQ ALDM+KIQYNK Sbjct: 301 KAETMLHTLKLRFPGLPQTALDMNKIQYNK 330